KEGG   Ictalurus punctatus (channel catfish): 108256449Help
Entry
108256449         CDS       T04658                                 

Definition
(RefSeq) septin-7-like
  KO
K16944  septin 7
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ipu04131]
    108256449
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ipu04812]
    108256449
   04147 Exosome [BR:ipu04147]
    108256449
Membrane trafficking [BR:ipu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    108256449
Cytoskeleton proteins [BR:ipu04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     108256449
Exosome [BR:ipu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108256449
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 AIG1 RsgA_GTPase AAA_22 Gtr1_RagA AAA_16 AAA_7 Roc AAA_29 ABC_tran Fez1
Motif
Other DBs
NCBI-GeneID: 108256449
NCBI-ProteinID: XP_017308835
UniProt: A0A2D0PUQ1
Position
23
AA seq 426 aa AA seqDB search
MAQQKNLEGYVGFASLPNQVYRKSVKRGFEFTLMVVGESGLGKSTMINSLFLTELYSSEH
QGPSHRVKKTVQVEHSKVLMKEGGVQLLLTMVDTPGFGDAVDNSNCWQPVIDHIDSKFED
YLNAESRVNRRQMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLT
PEECQQFKKQIMREIQEHKIKIYEFPETDDEEENKLVKKIKDRLPLAVVGSNTIIEANGK
KVRGRQYPWGVAEVENGDHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTCN
GMDNNKTKGQLTKADSVEGMSPLAQMEEERREHVTKMKKMEMEMEQVFEMKVKEKVQKLK
DSEAELQRRHEQMKKNLEAQHKELEERRRQFEEERANWESQQRFLEQQKLDASRTLEKKT
KKGKIF
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcacagcagaagaatctcgagggatacgtcggcttcgccagcctccccaaccaggtc
tacaggaagtctgtgaaacggggcttcgagttcacgctaatggtcgtgggtgagtcaggc
ttgggcaagtccacgatgattaactctctcttcctcaccgagctgtactcctcggagcac
cagggcccgtcgcacagagtcaagaaaaccgtgcaggtggagcactccaaagtgttgatg
aaggagggcggagttcagctgctgctcaccatggtggacactccggggtttggagacgct
gtcgataacagtaactgctggcagccggtcatcgatcacatcgacagcaagttcgaggat
tacctgaacgcagagtcgcgcgttaacaggaggcagatgcccgacaacagagttcactgc
tgcctgtacttcatcgctccttcaggacacggactgaagccgctggacatcgagttcatg
aaacggttgcacgagaaggtgaacatcatccctctgatcgccaaggcggataccctcacc
cccgaagagtgccaacagtttaagaaacagatcatgagagaaatccaggagcacaaaatc
aaaatctacgagtttccagagaccgacgacgaagaggagaacaagctcgtgaagaagatc
aaagatcgacttcctctggctgtagtcggcagcaacaccatcatcgaagcgaacgggaag
aaggttagagggaggcagtacccatggggtgtggcagaagttgaaaatggagaccactgc
gatttcaccattctgcggaacatgctcatcaggacccacatgcaggacctgaaggacgtc
accaacaacgtccactacgagaactacaggagcaggaagctggccgccgtcacctgcaac
ggcatggacaacaacaagaccaaaggacagctcaccaaagctgactcggtcgaaggcatg
agccccctggcgcagatggaggaggaaaggcgagagcacgtgactaagatgaagaagatg
gagatggagatggagcaggtgtttgagatgaaagtcaaggagaaggtccagaagctgaaa
gactccgaggcagagctgcagcggcgccacgagcagatgaagaagaacctggaggctcag
cacaaggagctcgaggaaaggagacgtcagttcgaggaggagagagcgaactgggagagc
cagcagcgcttcctcgagcagcagaaactcgacgcctccaggactctggaaaagaaaacg
aaaaaagggaagatattttaa

DBGET integrated database retrieval system