KEGG   Ictalurus punctatus (channel catfish): 108256957Help
Entry
108256957         CDS       T04658                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7-like
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ipu04131]
    108256957
Membrane trafficking [BR:ipu04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    108256957
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N TEA
Motif
Other DBs
NCBI-GeneID: 108256957
NCBI-ProteinID: XP_017309762
UniProt: A0A2D0PUT2
Position
24
AA seq 2118 aa AA seqDB search
MATLTSERRAFAHKINRTVAADVRKQVSREYGSPQLSKKRSGTHQSVPLTEVVEPVDYEE
YVSSHAPNPESGPLRQLLEFPSDDLELVLQERECATLEPALPDEDTLDPRVRDALGVYTE
DWLIIQRKYQCYSTIQSSHNTERRREKRRGLVKQTFELDEAAAIDRSDDQDDLKRRSLSL
DDTPRGSWASSIFDLKNSSADALLPCLLVHTAAEDMDHRNTENRQQGRHPDLLGLYPAPD
EDEAVERCSVPEVPKEHTGQRIMVKCLSLKFEIEIEPIFGTLALYDVKEKKKISENFHFD
LNSDQMKNMLRPHNPHTAISTLARSAIFSITDPSPDVFLVIKLEKVLQQGDIGECCEPYM
VIKDSDSVKHKEKLEKLKAQAEQSCSRLGRFRMPFAWTAIHLFNIVSSVGGLERSDSDSD
TERKGTWTERKKKGVERMSVGEDMCNLTNFRPATLTVTNFFKQEGDRLSDEDLYKFLADM
RRPSSVLRRLRPVTAQLKIDISPAPEVPHYCLSPELLHVKPYPDLRVRPTKEVLEFPARY
VYTPHTSYRNLLYVYPQSLNFSSRQGSVRNIAVKVQFMAGEDPNQAMPVIFGKSSCAEFN
KEAYTPVIYHDKAPEFYEEVKMKIPANLTDNHHLLFTFYHISCQPKQNTPLETPVGYTWI
PLMQHGRLRTGSFSLPVSVEKPPASYSVLTPDVQLPGMKWVDNHKGVFNVEVTAASSVHT
QDPYLDKFFTLVYVLEEYSFPFRLKDVIITEANVEAELKATMAALKSALLDTCVRFLHQL
LNKLILLIVHPPVIAGQIVNLGRAAFEAMALLVNQIHKNLEGNQDQHGRNSLLASYIHYC
FHLPTTEPVPPPTVSGSSYELPIQYATLSRATARPSSLLLSRSKSISNSNPDLASTPTSP
DDEVKRIIGSKGIDRSHSWVNSAYAPGGSRAVLRRNPNSSCELKQQASERSANRMSAFIE
STSLLAPPLKHMPRKLLHEELALQWVVSTSTVREAALQQAWFFFQLMVKSMAHHLFLTSK
LDVPRRQRFPDRFVDDIAALVCAISADIASRHHKDVELVERLNSSLAFFLNDLLSLLDRG
FVFNLIRTYYKQISNKLHTTQNPSSLMALRLDFMRIVCSHEHYVTLNLPCATFSPPSSPS
PSTSSTTSQSSAFSCPVQDQGVVSMFELSVPFRQQHFLSGLLLSELALILEPDGEGSMFF
LHKKAISAVHSLLCSHDADPRYTDPQVRAHIAQLYLPLIPIVTEALSQLHDFTDPSPQRV
RHASAVLDDSDPENSTINSSVAMAIAGSPLPYTKVSPFVLSSLAGRPCSALSAECSRTLL
VCVLWVLKNADAALLERWLSELSVLHINRLLDLLHLAISCFEYKGKKALERINSLTFKKS
QDMKARLEEAILGTIGARQEMVRRCRERSPYGGQENVRWRKNVTHWRQNADRVDKTKAEM
EQESVVDGNLATEASLIVLDTLEIIVKTVVLSEQKESVLGGVLRVLLHSMAGNQSALFLQ
HCFTTQRTLVFKFPEMLFEEDTELCADLCLRLLRHCSSSISSVRSHASASLYLLMRQNYE
IGNNFARVKMQVTMSLSSLVGTSQNFNEEHLRRSLKTILTYAEEDLELRDSPFPEQVQDL
VLNLHMILTDTVKMKEHQQDPEMLLDLMYRIAKGYQNSPDLRLTWLQNMAGKHSERGNHA
EAAHCLVHSAALVAEYLNMLEDCRYLPIGCVSFQNISSNVLEESAVSDDILSPEEEGICA
VKYFSEVGLVGLLEQAAASFNMAGMYEAINEVYKILCPIHEANRDFKKLASIHGKLQDAF
NKIYNQSSGWERMFGTYFRVGFYGCRFGDLDEQEFVYKEPSITKLAEISHRLEEFYSERF
GDDVVEIVKDSSPVDKNKLDPNKAYLQITYVEPFFDTYELKERITYFDKNYNLRMFMYCT
PFTLDGRAHGDLHEQYKRKTILTTSHAFPYIKTRINVIQKEEIILVPIEVAIEDMQKKTQ
ELAFATHQDPADSKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPEDPKLFRHHNKLRLCF
KDFMKRCEDALRKNKALIGPDQKEYHRELERNYSKLKEALCPLINRKIPQLYRAVQILPT
TPTQRNSLSRSSFRRTDC
NT seq 6357 nt NT seq  +upstreamnt  +downstreamnt
atggccactctgacaagcgagcggagagcttttgctcacaagattaacaggacggtagct
gcagacgtcagaaagcaggtatctcgggagtatggctcccctcagctctccaaaaaacga
agtggaacccatcagtcggtgccccttacggaagtggtggagccggtcgactatgaggag
tatgtgagcagtcatgcccctaaccctgagtctgggcctctcagacaactcctggagttc
ccctctgatgacctggagctcgtgctgcaggagagagagtgcgcaacactggaaccagcc
ctgcctgatgaagatacgctggatcccagagtgagagatgcgcttggggtctacactgaa
gactggctcattatccagagaaaataccaatgctacagtaccatacagagttcccacaac
accgagcggcgaagggagaagcggagaggcctggttaaacagacgtttgaactggacgag
gctgcagccattgaccgctcggatgaccaggatgaccttaagaggaggtcactgtctctg
gatgacacacctcggggcagctgggcctccagcatctttgacctgaagaactcctctgca
gatgccctgctgccttgtctgctggtgcacacagctgccgaggacatggaccaccgcaac
acggagaaccgtcagcaagggcgccaccctgacttactggggctttacccagcaccggat
gaggatgaggctgtggagaggtgctcagtccccgaggtacccaaagaacatacaggccag
agaatcatggtcaagtgtttgtctctcaagtttgagatcgagatcgaaccgatattcggg
acgctggctctgtatgacgtgaaggaaaagaaaaagatttcagagaactttcattttgac
ctgaactcggaccaaatgaagaacatgcttcgtccccataacccccacactgctatctcc
accctcgcccgctctgccatcttctccatcacagacccctctcctgatgtcttcctggtt
atcaagctggagaaggtcctgcagcagggagatataggagagtgctgtgagccatatatg
gtcataaaggattcagattcagttaagcacaaggagaaacttgagaaactgaaggcccag
gcagagcagtcatgcagccgtcttggacgcttccgaatgccctttgcctggacggccatc
caccttttcaacatcgtcagcagtgtcggggggctggagcgctctgactcggactcagac
acagagcgcaagggcacgtggaccgaaaggaagaagaagggagtcgagcggatgagtgtc
ggggaggacatgtgcaacttgaccaacttcaggccggccacgctgaccgtcaccaacttc
tttaaacaggaaggggacaggctgagtgatgaggacctgtataaatttttagctgacatg
agaagaccgtcttctgtgctgcgccgactccgacctgtgacagctcagttaaagatcgac
atttctcctgcacccgaggttcctcactactgtctttctcctgagctgctccatgtcaag
ccctaccctgacctgcgtgtacgtcctaccaaggaggtgctggagttccctgcacgctat
gtttatactcctcacaccagctataggaatctgctgtatgtatatccccagagtcttaat
ttcagcagtagacagggttctgtacggaacattgccgtaaaggtgcagttcatggcagga
gaggatcccaaccaagccatgcctgtcatatttggaaaatccagttgtgcagagttcaac
aaagaggcatatacaccagtgatctaccatgataaggctcctgaattctacgaggaggtg
aagatgaaaattcctgctaacctcactgacaaccaccacctgctgttcaccttctaccac
atcagctgtcaacccaaacagaacactccgctcgagacgcctgtgggctacacctggatt
ccgctgatgcagcatggccgtctgcgcacgggatccttcagcctacctgtgtccgtggag
aaacccccagccagctactccgtcctcacccctgatgtacagcttccaggaatgaagtgg
gtggacaatcacaaaggagtgttcaatgtagaggtgacagctgcttcctctgtccacact
caggacccatacctggataagttcttcaccctggtgtatgtcttagaggagtactctttc
ccgttccgactaaaggatgtgatcatcaccgaggccaatgtggaggctgagctgaaagcc
accatggcagccctgaagtcagcactgttggatacctgtgtgcgcttcctgcaccagctt
ctgaacaaactcatcctcctcatcgtccaccctcctgtcatcgctggccagatcgtgaac
ttgggccgtgcagccttcgaggctatggcactcctagtcaaccaaattcataagaatctg
gaagggaaccaagatcagcatggccgcaacagtctgttggcctcttatatccactactgc
ttccatctgcccaccactgagcctgtgccaccccctactgtgagtggatcttcctatgag
cttcctatccaatatgcaacgttgtcccgggcaactgcccgccccagcagtctgctcttg
tcccgctccaagagcatcagcaactctaaccccgacctggcatccacacctacctcacct
gatgatgaagtaaaaaggatcattggcagcaagggaatagaccgatctcactcctgggta
aactctgcttacgctcctgggggctctagagctgtgctccgtcggaaccccaactccagc
tgtgagctaaagcagcaggccagtgaacgatctgctaaccgcatgtcggcgttcatcgag
agcacctccttacttgcaccacctttgaaacacatgcccaggaagctgttgcacgaggag
ctggctctgcagtgggtggtgagcaccagcacagtgagagaggcagcgctgcagcaagcc
tggtttttcttccagctcatggtgaagagtatggctcatcaccttttccttacttccaag
ctggacgtgccgcgacgtcagcgttttccggaccgttttgtggacgatatcgctgccttg
gtatgcgccatcagtgcagatattgccagcagacaccacaaggatgttgagcttgtggaa
agattaaacagcagcctggccttcttcctcaatgacctgctgtctctccttgatcgggga
tttgtgtttaacctcatccgtacctactacaaacagatttccaataaactgcacacaaca
cagaacccaagctctctgatggctttgaggctggacttcatgcgtatagtgtgcagtcac
gagcactacgtcactctcaacctgccatgtgctaccttcagccctccatcctctccatca
ccctcaacctcctctaccacctctcagagttcagcattctcgtgtccggtgcaggatcag
ggtgtagtcagtatgttcgagctgtccgtgccctttcgccagcagcatttcctgtctggc
ttactgctgtctgagctcgcccttatcctggaacctgatggagaaggcagcatgttcttc
ctgcacaagaaggcgatcagtgcggtgcactctctcctgtgcagtcatgatgcagaccca
cgctacactgacccgcaggttcgagcccatatcgctcagctctatcttccactcattcct
atcgtcacggaggcgctatcccaactccatgatttcaccgacccctcgcctcagcgtgta
cgccacgcttctgcggtcctcgatgacagcgatccagagaacagcaccattaattcgtcc
gttgctatggcgatcgccggctcgccactaccgtataccaaagtcagtcccttcgtgctg
tcctcgctggcgggtcgtccgtgcagcgcgctctccgccgagtgcagcaggactctcctg
gtgtgtgttctgtgggtgttgaagaatgctgatgcagccttgctggagcgctggctctct
gagctgtctgtgctgcacatcaaccgactgcttgaccttctccacctcgccatctcctgc
ttcgagtacaaggggaagaaggctctggagcggatcaacagtctgacgtttaagaagtct
caggacatgaaagcccgtctggaggaagccatactaggcactattggagcccgtcaggag
atggtccggcgctgtcgagaaaggagcccttatggtggccaggagaatgtacgatggagg
aagaacgtcactcactggagacagaatgcagacagagttgacaagacaaaagcagagatg
gaacaggagtccgtggtggatggaaacttggcaactgaagcttccttaatagtcttggac
actctggagatcattgtcaaaacggtagtgctgtctgagcagaaggagagtgtgctgggc
ggagtgctgagagtacttcttcacagcatggctggcaaccagagcgcactttttctgcaa
cactgctttactacgcagagaaccctggtcttcaagttcccggagatgctttttgaggag
gacacagagctgtgtgctgatctgtgtctgcgtttattgcgtcactgcagcagcagtatt
agctctgtacgcagtcatgccagcgcttccctctacttgctcatgagacagaactacgag
atcggcaataactttgcacgagtgaagatgcaggttaccatgtctctatcatcgctggtg
ggcacctcccagaacttcaacgaagaacacctgcgccgctccctcaagaccattctcacc
tacgcagaggaagatctggagcttcgagactcgcccttcccagagcaggtccaggacctt
gtgttaaacctgcacatgattctcactgacacagtgaagatgaaagagcatcagcaggac
cctgagatgctgctcgacctcatgtacaggattgccaagggctatcagaactctccagac
ctgcgtctcacctggctacagaacatggccggaaagcactccgagagaggcaaccatgct
gaagccgcccactgcctggtccacagcgctgccctggtagccgagtacctcaacatgctg
gaggactgtcgctacctccccattggctgtgtctccttccagaatatctcctctaacgtg
ctggaagagtctgctgtatctgacgacatcttgtccccggaggaagagggcatctgtgcg
gtgaaatatttcagcgaggtcggactggtggggttgctggaacaagcggcggcctccttt
aacatggctggtatgtatgaagccattaatgaggtctataagattctctgccccatccat
gaggccaacagagactttaagaagctggcctccatccatggcaagctgcaggatgccttc
aacaaaatctacaatcagagttcaggatgggagaggatgtttggcacatatttccgtgtg
ggtttttacggctgccgctttggcgacctagacgaacaggagtttgtgtataaggagcct
tctatcacaaaactggccgagatttcacacaggctggaggagttctactcggagcgcttt
ggtgatgatgtcgtggagattgtcaaggactccagccctgtggacaagaacaagctggac
cccaacaaggcgtacctacaaattacgtacgtggagccttttttcgacacgtacgagctg
aaggagcgcatcacgtatttcgacaagaactacaacctgcgcatgttcatgtactgcaca
ccgtttacgctagacggccgtgcgcacggtgacctgcacgagcagtacaaacggaagacc
atcctcaccacctcacatgctttcccttacatcaagacccgcatcaatgtcatccaaaag
gaagagataatccttgttccaattgaagtggctattgaggacatgcagaagaagactcag
gagctggcctttgccacacaccaggatcctgcagactccaagatgctgcagatggtgctt
cagggcagtgtgggcaccactgttaaccagggtcctcttgaggtggcccaggtattcttg
tctgaaattccagaagacccaaaactcttccgacatcataacaaactgcgtctctgcttc
aaggacttcatgaagagatgtgaggatgctctgaggaagaacaaggctctgattggacca
gaccagaaagagtaccacagggaactagagaggaactacagtaagctgaaggaggctctg
tgccctctcattaaccgcaagatcccccaactctatcgagcagtccagatactgcctacc
acacctacacaaaggaattcccttagcaggtccagctttcggcggacagactgttaa

DBGET integrated database retrieval system