KEGG   Ictalurus punctatus (channel catfish): 108257972Help
Entry
108257972         CDS       T04658                                 

Definition
(RefSeq) cytosolic phospholipase A2-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00564  Glycerophospholipid metabolism
ipu00565  Ether lipid metabolism
ipu00590  Arachidonic acid metabolism
ipu00591  Linoleic acid metabolism
ipu00592  alpha-Linolenic acid metabolism
ipu01100  Metabolic pathways
ipu04010  MAPK signaling pathway
ipu04217  Necroptosis
ipu04270  Vascular smooth muscle contraction
ipu04370  VEGF signaling pathway
ipu04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    108257972
   00565 Ether lipid metabolism
    108257972
   00590 Arachidonic acid metabolism
    108257972
   00591 Linoleic acid metabolism
    108257972
   00592 alpha-Linolenic acid metabolism
    108257972
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108257972
   04370 VEGF signaling pathway
    108257972
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108257972
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    108257972
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108257972
Enzymes [BR:ipu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     108257972
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 108257972
NCBI-ProteinID: XP_017311651
UniProt: A0A2D0Q1U3
Position
25
AA seq 741 aa AA seqDB search
MMSARDPDQYIIVEQQYSHKFKVKVLRAENVTKGTLGDLLDTPDPYVELFIPTAPESRKR
TRHIDNDINPEWDESFEFILDPNQDNVLEVTLMDANYVVDETLGMTSYSISKLKVGEKEL
VSILIGKTTKVFLELSLEICSAIDLRFSLALCDKEKLYRQQRREKVMLGIKKLLDMEKPR
FLPSSPQEVPVIAVVGSGGGFRAMVGFSGVMKALYESGVLDCSTYIAGLSGSTWYMSMLY
SHPEFPKKGPEQINEELMKSVSSNPLRLLLPQHITNYVQALWTKKSNGQPVTFTDIFGML
IGETLIPARMDSKLSEMQEKINDAQSPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMSK
YGTFMTPDLFGSKFFMGTVVKRYEENPLHFLMGVWGSAFSILFNRVLGVKDIPGGSTMEE
ELEHIKPEHIVGEDSLDNDEESHKVCMQDDRQQEQASWMQRMVTSLFSDSTLFNTREGRA
GKVHNFMLGLNLSTSIPLAPYSDVLAQNYPEDEADAVTDPDEFDRIYEPLDVKSKKIHIV
DSGLTYNLPYPLILRPQRGVDLIISFDFSARPGDSSPPFKELLLAEKWARMNKLPFPRID
PKVFDREGMKECYVFKPSKGNKNCPTVIHFVLVNLDFRKFKAPGIPRETEADKQFADFDI
FDDPETPYSTFNFQYSNKAFTQLHDLMEFNTLNNIEVIKEAIKESVVYRKENPSRCSVSL
SLNDIQNKKILKRDTTGLVHK
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccgccagagatcctgatcagtacatcattgtcgagcagcagtactcccacaag
ttcaaagtgaaagttctgcgggcagaaaatgtcaccaaaggcactctgggagacttgctg
gacaccccggacccgtacgtggagcttttcattcccacagctcccgagagcaggaagagg
acacggcacattgataacgacatcaaccctgagtgggacgaaagcttcgagttcatactg
gacccaaaccaggacaatgttctggaggtgacattaatggacgctaattacgtggtggac
gagacactgggtatgacgtcgtattccatttccaaactcaaagtgggagagaaggaactg
gtgtcaattcttataggaaaaaccaccaaagtgttcttagagctcagtctggaaatttgt
tctgccattgacctgcgcttcagtcttgccctgtgtgataaggagaagttgtacaggcag
cagcgaagagagaaggtcatgctgggtatcaagaaactgctggacatggagaagcctcga
ttcctgccctcgagcccccaggaggtccctgtcatcgctgtggtaggatcaggtggtggg
ttcagggcgatggtcggcttctcaggcgtaatgaaggccttgtacgagtcgggagttctg
gactgctcaacatacatcgctggcctctctggctccacatggtacatgtctatgctgtac
tctcacccggagttccctaagaaaggcccggagcagattaatgaggagctgatgaagagc
gtgagcagcaaccccctccgcctgctcctgccgcagcacatcaccaactacgtccaggcc
ctgtggaccaaaaagtctaacggccagcctgtcacctttaccgacatttttggcatgctt
atcggagaaacactgattccagctaggatggacagtaagctgagtgagatgcaggagaag
attaacgacgcacagtctcctttgccgctctttacctgcctgcacgtcaaaccggacgtg
tccgagctcatgttcgccgattgggtggagttcagtccttatgagatcggcatgtctaaa
tatggcacgttcatgacccctgaccttttcggcagcaaattcttcatgggaactgttgtt
aagagatatgaggagaatcctctgcacttcctgatgggggtctggggcagtgccttctcc
attctttttaacagggtattgggggtaaaggacatccctggggggagcaccatggaggag
gagctggaacatataaaacctgagcatattgttggagaagacagcctggacaatgatgaa
gagtcccacaaagtctgcatgcaggacgaccgtcagcaggaacaggccagctggatgcag
cgcatggtcacgtctctgttcagcgactccacgctgtttaacacgcgcgagggcagggcg
ggaaaagtgcacaacttcatgctgggtctcaacctgagcaccagcatcccgctcgcgccc
tacagcgacgtcctggcccaaaactatcccgaggatgaagcggatgctgtaacagacccc
gatgagtttgaccgaatctacgagccgctagacgtaaagagcaagaagatccacatcgtg
gacagcggcctgacctataacctgccctaccctttgatcctgagaccccagaggggtgtg
gacctcattatctccttcgacttctcggctcgacctggcgactctagtcctccgttcaag
gagcttctgttggctgagaaatgggcacgcatgaacaagcttccgtttcccagaatcgat
cccaaagtgtttgaccgggaagggatgaaagagtgctacgtctttaagccgagtaagggg
aacaagaactgccccaccgtcattcatttcgtcttggttaacctagacttcagaaagttc
aaagccccaggaattcctcgagagactgaagcggacaaacagtttgccgactttgacatc
tttgatgacccggaaacaccgtactccacctttaacttccagtattccaacaaggccttc
actcagctgcatgacctcatggagttcaacacgctcaacaacatagaggtgatcaaagag
gcaattaaggagagcgttgtgtacaggaaggagaacccatctcgctgctccgtgtctctt
tctctcaatgacatacagaacaagaagattttgaagagggatactacaggcctcgtgcac
aaatga

DBGET integrated database retrieval system