KEGG   Ictalurus punctatus (channel catfish): 108258666Help
Entry
108258666         CDS       T04658                                 

Gene name
plk1
Definition
(RefSeq) polo like kinase 1
  KO
K06631  polo-like kinase 1 [EC:2.7.11.21]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04068  FoxO signaling pathway
ipu04110  Cell cycle
ipu04114  Oocyte meiosis
ipu04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    108258666 (plk1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108258666 (plk1)
   04114 Oocyte meiosis
    108258666 (plk1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    108258666 (plk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ipu01001]
    108258666 (plk1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ipu03036]
    108258666 (plk1)
Enzymes [BR:ipu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     108258666 (plk1)
Protein kinases [BR:ipu01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   108258666 (plk1)
Chromosome and associated proteins [BR:ipu03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     108258666 (plk1)
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    108258666 (plk1)
  Sister chromatid separation proteins
   Polo kinases
    108258666 (plk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase POLO_box Pkinase_Tyr Kinase-like Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 108258666
NCBI-ProteinID: XP_017312954
UniProt: A0A2D0Q3S0
Position
26
AA seq 591 aa AA seqDB search
MSAGMAKAVKPSSHVDPKSAPLKEIPDILVDPRSMKRYMRGRFLGKGGFAKCYEITDMDT
KEVFAGKVVPKSLLMKPHQKEKMSTEIAIHKSLDNPHVVGFHGFFEDDDFVFVVLEICRR
RSLLELHKRRKAVTEPEARYFMRQTVQGVHYLHNNRVIHRDLKLGNLFLSDDMEVKIGDF
GLATKIEFDGERKKTLCGTPNYIAPEVLCKKGHSFEVDVWSLGCILYTLLVGKPPFETTC
LKETYVRIKKNDYTIPRHINPVATALIRRMLHADPTLRPSVADLLADEFFTSGYVPLRLP
TSCLTVPPRFSIAPSSLEAGLHRKPLSTFNKETDSPIEKIGKVEQLLKEEPRDGPEQPDC
HLTDMLQQLTSLNTARPSEREFIRQEEAEDPACIPIFWISKWVDYSDKYGLGYQLCDNSV
GVLFNDSTRLIMYEDGDSLQYIDRVGAESYLSVRSYPAALSKKITLLKYFRNYMSEHLLK
AGANITPRDGDELTRLPYLRHWFRTKSAIVLHLSNGTVQINFFQDHTKLILCPLMGAVTY
INERRDFRTYKMSLIEEHGCCNQLAARLRYGRSMVEKLLSCKSTATTASAR
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaggcatggcgaaggcggtgaagccttcatcacacgtcgaccccaagtctgct
cctctgaaggagatcccggacatcctggtggatccgcggagcatgaagcgctacatgagg
ggacgcttcctgggcaaaggcggcttcgccaagtgctacgagatcacagacatggacact
aaggaggtgttcgcggggaaagtcgtgcccaagtcgctgctaatgaaaccgcaccagaag
gagaagatgagcacggagatcgccatccacaagagcctggacaacccgcacgtcgtcggc
ttccacggcttcttcgaggacgatgacttcgtgttcgtcgtgctggagatctgcaggaga
aggtccctcttggagctgcacaagcgcaggaaggccgtgacggagcccgaggcgagatac
ttcatgcgccagacggtccagggcgttcactacctccacaacaacagagtcatccaccgt
gacctgaaactgggcaacctgttcctgagcgacgacatggaggttaagattggtgacttc
ggcttggccaccaagatcgagtttgacggcgagaggaagaagacgctgtgcggcacgccg
aactacatcgcccccgaggtgctgtgcaagaaaggccacagttttgaggtggacgtgtgg
tccctgggctgcattctgtacacgctgctggtgggaaagccgccgttcgagacgacgtgc
ctgaaggagacgtacgtccgcatcaagaagaacgattacaccattcccaggcacattaac
cccgtggccacggcgctaatccggcggatgctgcacgccgaccccacgctccgcccttcc
gtcgccgacctgctcgcagacgagttcttcacctcgggttacgttcctctgaggctgccg
acgtcctgcctgaccgtaccgcccaggttctctatcgccccctccagcctggaggccggc
ctgcatcgcaaacctctctcaacttttaataaagaaaccgacagtccgattgagaaaata
gggaaggtggagcagcttctgaaagaggagccaagggacggaccggaacagcccgactgc
cacctgaccgacatgctgcagcagctgacgagcctcaacacggccaggccatcagagaga
gagttcatacggcaagaggaagctgaggacccggcctgcatccccatcttctggatcagc
aaatgggtcgattactccgataagtatggcctagggtatcagctgtgtgataacagcgtc
ggcgttttgttcaacgactccacccgcttgatcatgtacgaagacggagacagtctgcag
tacatcgaccgcgtcggggcggagtcttacctcagcgtgcgctcctacccagctgccctc
tctaaaaagatcactctgctgaagtatttcaggaactacatgagcgagcacttgttgaag
gcgggtgctaacatcacgccgcgcgacggagacgagctcacgcgcctgccctacctgcgc
cactggttccgcacgaagagcgccatcgtgctccacctgagcaacggcacggtgcagatc
aacttcttccaggaccacacgaagctgatcctgtgccccctcatgggtgccgtgacgtac
atcaacgagcgccgtgacttccgcacctacaagatgagtctgatcgaggagcacggctgc
tgtaaccagctggccgcgcgcctgcgctacggccgcagcatggtggagaaactcctgtcc
tgcaaaagcacagccaccacggcctccgcccgctag

DBGET integrated database retrieval system