KEGG   Ictalurus punctatus (channel catfish): 108258999Help
Entry
108258999         CDS       T04658                                 

Gene name
tpp2
Definition
(RefSeq) tripeptidyl peptidase 2
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ipu01002]
    108258999 (tpp2)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ipu03110]
    108258999 (tpp2)
Enzymes [BR:ipu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     108258999 (tpp2)
Peptidases and inhibitors [BR:ipu01002]
 Serine peptidases
  Family S8: subtilisin family
   108258999 (tpp2)
Chaperones and folding catalysts [BR:ipu03110]
 Intramolecular chaperones
  Subtilisin family
   108258999 (tpp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII TPPII_N
Motif
Other DBs
NCBI-GeneID: 108258999
NCBI-ProteinID: XP_017313587
UniProt: A0A2D0Q5L4
Position
26
AA seq 1263 aa AA seqDB search
MASRSIEDSFPLHGLLPKKETGAASFLTRFPEYDGRGVLIAILDTGVDPGAPGMQTTTEG
KPKIVDIIDTTGSGDVNMSTVAEPKDEEVLGLSGRTLKIPPAWVNPSGKYRIGVKNGYEF
FPKPLKERIQKERKEKMWDPAHRAALAEASRKTEEFDLAHPNPSQVEKLQKEELQSQTEL
LGTMEKKYSDPGPVYDCVAWHDGVTWRAVVDTSESGDLASCTVLSSYRERQEYAMLGDAE
MLNYSINIYDEGNTLCIVTSGGAHGTHVASIAAGYFPEEPERNGVAPGAQILALKIGDTR
LSTMETGTGLIRAMIEVINYKCDLVNYSYGEATHWPNSGRICEVISEAVQKHNVMYVSSA
GNNGPCLSTVGCPGGTTSSVVGVGAYVTPDMMVAEYSLREKLPPNQYTWSSRGPSTDGAL
GVSISAPGGAIASVPNWTLRGTQLMNGTSMSSPNACGGIALVLSGLKQNGMRPTVAAVRR
ALENTANKVDDVEVFAQGHGIIQVEKAFDYLMQHASTPTYNLGFTVTVGNQRGIYLRDAV
QVSTPSDHGVGIEPVFPENTENSVRISLQLHLALTCSAPWVQCPAHLELMNQCRHVNVRV
DPQGLREGLHYTEVCAYDTSAPSAGPLFRVPITVIIPTKVTESQNQEVTFMDVHFRPGQI
RRHFITVPQGTSWAEIMLTSRSPDVSSKFVLHAVHLVKQRAYRANEFYKFSSLLEKGSLT
EAFPVLPGRTVEVCIARWWASLGDVIVDYTISFHGLRTSPSPLHIHASEGITSFEVSSPV
RYEEVSPTITLKNWVQPLRPISSKTKALGSRDVLPNNRQLYEIVLTYSFHQPKSGEVTPS
CPLLCELLYESEFDSQLWLLFDQNKRLMGSGDAYPHQYSLKLEKGDYTIRLQVRHEQQSE
LERLKDLPFVVSHRLSNTLSLDVYETHRAAMLAKKKANSLTLAPGTSQPFYITSLSDDKI
PKGTGPGCYMTGSLVVPKSEYGKKAGQASAKRQGKFKKDIVQIFYHLISAPNKSKNGGKE
KDKDGEKEKDVKEEFSEALRDLKIQWMTKLDNNTLYDELKENFANYLPLHVQRLHQLDSE
KERLKRLQDIMSAADIVISHIDQTALAVYLTMKTDPRPDAASIKSDMEKQKSSLLDALCR
KGCALADQLMQPPEQEGASANEVGSSEDDPHGVTKALTDTFWEVQKWVDLTDSKVLSFSY
KHALANKMYGRALKYASKIVEDKPSKENWKNCIQLMKSLGWMHCATYTENWLPIMYPSDY
TPF
NT seq 3792 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcgctctattgaagattccttccctttacacgggctgttgccgaaaaaggag
accggcgctgcttcattcctgaccaggtttcctgagtacgatggacggggggtgcttatc
gccatcctggacaccggggtggacccgggggcgccgggcatgcagaccactacagagggc
aagcctaagattgtggacatcatcgatacgacgggcagtggcgacgtcaacatgtccaca
gtggcggagccgaaagatgaagaagtgctcgggctttctggacgcacgctcaagatccct
cctgcctgggtgaacccatcaggaaaatatcgcatcggtgttaaaaatggttatgagttt
ttccccaaaccgctcaaagagaggatacagaaagagcgcaaggagaagatgtgggacccg
gcccacagagcagctctcgccgaggccagtcgcaagacggaggagtttgaccttgctcac
cccaacccctcacaggtggagaagctgcagaaggaggagttgcagagccaaactgagctg
ttaggcaccatggagaagaagtacagcgaccctgggcctgtctacgactgcgtggcgtgg
cacgatggcgtcacctggagggcagtggtggatacgtcagagagtggagacctggcgtcc
tgtaccgtgcttagctcctacagagaaagacaggagtatgccatgctaggagatgctgag
atgctcaattactccatcaacatctatgatgaaggaaatactctctgcattgtcactagt
ggaggtgctcatgggactcatgtcgccagtatagcggcaggttacttccccgaggagcca
gagagaaacggcgtggcccctggtgcccaaatcctggcactgaaaataggggatactcgc
ctgagcacgatggagacgggaacaggcctcatccgagcgatgatcgaggtcattaactac
aagtgtgaccttgtaaactacagctatggggaggcaacccactggccgaactcagggaga
atctgtgaagtaatcagcgaggcggtgcagaaacataatgtcatgtacgtgtcgagcgct
gggaacaacgggccctgtctctccactgtgggatgtccgggaggaaccacgagtagcgtc
gtaggtgttggtgcttatgtcacacctgacatgatggtggcagaatattcattgagggag
aagctgcctcctaaccagtacacgtggtcctcaaggggtcccagtactgatggagctctg
ggtgtcagcatcagtgcacctgggggagccatcgcctctgtgcccaactggacattgcgt
ggcacgcagctaatgaacggcacctccatgtcctctcccaacgcctgtggaggcatcgcg
ctcgtactctcaggtctgaagcagaacgggatgcgaccgacagttgcagctgtgagacgt
gctttggaaaacacggccaacaaagtggatgacgttgaagtgttcgcgcagggtcatggc
attattcaggtggaaaaggcgtttgactacctcatgcagcatgcttccactcccacctat
aacctgggcttcacagtcactgtagggaatcagcggggcatctacctcagggacgccgtc
caagtctccactccctctgatcacggagttggaatcgagccggtctttccagaaaacact
gaaaactctgtacgaatctcgctgcagttacacctggcactcacctgcagcgcgccgtgg
gtgcagtgccccgctcacttggagctcatgaaccagtgccgtcacgttaacgtccgcgtc
gacccacagggactacgagagggcctgcattataccgaggtgtgtgcttatgatacctct
gcacccagtgctggtcccctcttcagagtccccataacggttataatccccacaaaggtt
acagagagccagaatcaggaggtcaccttcatggacgttcacttcagaccaggccagata
cgacgccattttatcaccgtccctcaaggaacctcgtgggcagagatcatgttaacgtct
cgctcccctgatgtctcctccaagtttgtcctccatgccgtgcacctggtgaagcagagg
gcttaccgagctaatgagttctacaaattctcctcgctgctggagaagggctcgctcaca
gaggcgttccctgtgctgcctggacgaacggtagaggtgtgcatcgctcgttggtgggcc
agtcttggcgatgtcatcgtagattataccatttccttccacgggctgcgaacgtctccc
tctcctcttcatatacatgcttctgagggcataaccagttttgaggtgtcgtctcctgtt
agatacgaggaggtctccccaaccattactctgaagaactgggtgcagccccttaggcca
ataagttccaaaacaaaagcgcttggctccagagacgtattacccaacaatcgtcagctt
tatgaaatcgtccttacgtacagctttcatcagcctaaaagtggagaggtgacccccagt
tgtccgctactgtgtgagctgctgtacgagtcggagtttgacagccagctctggctcctc
tttgaccagaacaagaggctcatgggctcgggagatgcttatcctcaccagtactctttg
aagctggagaaaggggactacaccatccggctgcaggttcgccacgagcagcagagtgag
ttggagcggctgaaagatctgcctttcgtagtgtctcatcgcctctccaacaccctgagc
ctggacgtgtacgagacacaccgggcggccatgctggcgaagaagaaagcaaactcgctc
actcttgcaccaggaacctctcagccattctacatcacctctctatcagatgacaagata
cctaaaggtacaggtccagggtgctacatgaccggctctctggttgtaccgaagagcgag
tacgggaaaaaagcaggccaagcctcagccaaacgacaaggaaaatttaaaaaggacata
gtgcaaattttctaccacctgatctcagcccctaacaaatcaaagaacggaggaaaagag
aaggacaaggacggggagaaagagaaggacgtgaaggaggaattctccgaagccctccga
gacttgaagatccagtggatgacaaagttggacaataatacgttatatgatgaactgaag
gagaactttgcaaattatctccctctccatgtccaacgactgcatcagctggattcagag
aaggagcgactgaagcgattgcaagacatcatgtcagcagcagatattgttatttctcac
attgaccagactgcactggcagtgtatctcacgatgaagacagaccctcgtccagacgcg
gcctctataaagagtgatatggagaagcagaagtcgtccctgctggacgctctctgtagg
aaaggctgtgctctggctgatcagctcatgcagcctccagagcaggagggggcgagcgcg
aacgaggtgggcagctctgaagacgacccacacggcgtgactaaagcactgaccgacact
ttctgggaggttcaaaagtgggtcgacctcaccgactctaaggttctgtcgttttcctac
aaacatgccttagcaaataaaatgtatggaagagctttgaaatacgcttcgaaaattgta
gaagacaaacccagcaaagaaaactggaagaactgcattcagctgatgaagtctctgggc
tggatgcactgcgccacctacactgaaaactggcttcccatcatgtatccctcagactac
acacctttctaa

DBGET integrated database retrieval system