KEGG   Ictalurus punctatus (channel catfish): 108259370Help
Entry
108259370         CDS       T04658                                 

Definition
(RefSeq) arylamine N-acetyltransferase, pineal gland isozyme NAT-10-like
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00232  Caffeine metabolism
ipu00983  Drug metabolism - other enzymes
ipu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    108259370
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    108259370
Enzymes [BR:ipu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     108259370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 108259370
NCBI-ProteinID: XP_017314286
UniProt: A0A2D0Q9A1
Position
27
AA seq 314 aa AA seqDB search
MVVCEGFFSRRHAGLVIQLYFATVMDLQEYFRRIGFGGTYEKPDLATLRTVHELHVMSVP
FENLSIHCGERNTMDLQIIYEKIVRNRRGGWCCENNLLFSWVLREMGYKYTTLGSRVFKT
FKNDFSPMDSHLINMVEIEGKPYIADVSFGLSYQIWYPLEIIAGKDQEQPAGIFRLLNDG
EKWMLQKTGRKPLVQNEAFANSSLINKRLTTMLYSFVLTPREIDHFLNTSEYLQTSPESL
FTQKSICSLQTPTGFRALIGWTFSEVTFNPEEDTDMYEMSALADSEIETILKEKFNIVLV
NKLTPINSKAAYKL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggttgtttgtgaagggtttttttctcgaaggcatgccggacttgttattcagctttat
tttgcgaccgtaatggatcttcaggaatacttcagaaggatcgggttcggcgggacgtac
gagaaacccgatctggccacgctccgcaccgtccacgagctgcacgtgatgagcgttccc
ttcgagaacctcagcatccactgtggagagaggaacaccatggacctgcagatcatttat
gagaagattgtgagaaaccgtcgtggaggatggtgctgtgaaaacaacctgctcttctcc
tgggtgctgagagagatgggctacaaatacaccacgctgggctctagagtcttcaaaacg
ttcaaaaatgacttcagccccatggattcacacctcattaacatggtggagatcgaaggc
aagccgtatatcgcagacgtgagttttggactgtcataccaaatctggtacccgttagaa
attatcgcagggaaagatcaagagcagccggcggggattttccgcctgttgaacgacggt
gagaagtggatgctgcagaagactggaaggaagccgctggtccagaatgaagccttcgcc
aattccagcctcattaacaagcgcctgacgacgatgctgtactcttttgtgttaacaccg
cgtgagattgaccattttctgaacacaagcgagtacctgcagaccagccccgagtctctg
ttcacccagaaatccatttgttccctccagacccccactggattcagagctctgattggt
tggaccttcagtgaagtcacatttaaccctgaggaagacacggacatgtatgagatgagc
gctctagctgacagcgagatagagactatactcaaggaaaagtttaatatcgttttagtt
aataaactgacaccaataaatagcaaagctgcatataaactgtag

DBGET integrated database retrieval system