KEGG   Ictalurus punctatus (channel catfish): 108260517Help
Entry
108260517         CDS       T04658                                 

Gene name
suclg1
Definition
(RefSeq) succinate-CoA ligase alpha subunit
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00020  Citrate cycle (TCA cycle)
ipu00640  Propanoate metabolism
ipu01100  Metabolic pathways
ipu01200  Carbon metabolism
Module
ipu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ipu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    108260517 (suclg1)
   00640 Propanoate metabolism
    108260517 (suclg1)
Enzymes [BR:ipu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     108260517 (suclg1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     108260517 (suclg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 108260517
NCBI-ProteinID: XP_017316372
UniProt: A0A2D0QDI6
Position
29
AA seq 326 aa AA seqDB search
MSHCRLLARLLLQQQQVGVRHCYTATRKSLYISKDTKVICQGFTGKQGTFHSQQSLDYGS
KLVGGVSPGKGGKTHLGLPVFNSVKEAKEGTGADATVIYVPPPFAAAAIIEAIDAEIPLA
VCITEGIPQQDMVRVKHRLLRQNVTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVS
RSGTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTNFIDCLEVFLQDPKTEGIILIGEIGG
DAEENAAEFLKQHNTGANIKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKIAALQS
AGVVVSMSPAQLGSTMLKEFEKRKML
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtctcactgcagattgctagcgcggctcctcttgcagcagcagcaggtgggagtgaga
cactgttacacggccacacggaagagtctctacatcagcaaggacactaaagtcatctgt
cagggcttcacaggaaaacagggaacgttccacagtcagcagtctctggattatggctcc
aagttagtcggaggcgtgtctcctggaaaaggcgggaaaactcacctgggtttgccggtg
ttcaactctgtgaaggaggcgaaggaggggacaggcgccgacgccacggtgatctacgtc
ccccctccgttcgccgcggcggccatcatagaagccatcgacgccgagataccgctggcg
gtgtgtatcacggagggaatcccacagcaggacatggtgcgggtcaaacacaggctcctc
cgccagaacgtcacccgcctcatcgggcccaactgccccggcgtcatcaaccccggagag
tgtaaaatcgggatcatgcccggacacattcacaagaaaggaagaatcggcatcgtgtcg
aggtcgggcaccctgacgtacgaagcggtgcaccagactacgcaggtgggactgggccag
tctctgtgtgtcggaatcggcggagatccgtttaacggcacaaacttcatcgactgtctc
gaggtgttcctgcaggacccgaaaacggagggcatcatcctgatcggagagatcgggggc
gacgccgaggagaacgcagccgagtttctgaagcagcacaacacgggtgctaacattaaa
ccggtggtgtcgtttatcgccgggctcacggcgccccccggcaggaggatgggtcacgcc
ggtgccatcatcgcaggaggaaagggcggggctaaagagaagatcgccgccctgcagtcc
gccggcgtggtggtcagcatgtcccccgcccagctggggagtaccatgctgaaggaattc
gagaagaggaagatgctgtaa

DBGET integrated database retrieval system