KEGG   Ictalurus punctatus (channel catfish): 108260803
Entry
108260803         CDS       T04658                                 

Definition
(RefSeq) adenylate cyclase type 4-like
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00230  Purine metabolism
ipu01100  Metabolic pathways
ipu04020  Calcium signaling pathway
ipu04114  Oocyte meiosis
ipu04261  Adrenergic signaling in cardiomyocytes
ipu04270  Vascular smooth muscle contraction
ipu04371  Apelin signaling pathway
ipu04540  Gap junction
ipu04912  GnRH signaling pathway
ipu04914  Progesterone-mediated oocyte maturation
ipu04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108260803
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108260803
   04020 Calcium signaling pathway
    108260803
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108260803
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108260803
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    108260803
   04914 Progesterone-mediated oocyte maturation
    108260803
   04916 Melanogenesis
    108260803
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108260803
   04270 Vascular smooth muscle contraction
    108260803
Enzymes [BR:ipu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     108260803
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053
Other DBs
NCBI-GeneID: 108260803
NCBI-ProteinID: XP_017316887
UniProt: A0A2D0QF00
Position
29
AA seq 1218 aa
MKTSIRKQKEHWVTMQDDSHDCLEMITKYPEDLSQQKGDINQIRKQSKHEGIQKANKSAQ
DGDKQPTGSGIRQHNIELGIAKKENTPEPLQACTSFRTSNTTTNGPAYPSLPEAIMEDNT
NSGLGNCLQSCRTDHDCTEAEPDVMGVPERQSVRIRRTTATGACRCYQAVRLGFLQCLED
TPFVVPGLVLTILFCVTIIVIIAATGRHITGYVGALSVVCVVLCLCVPLLVCLPCLPTLR
RCEQMLALSIWFMLFITAIVFIFTDKVVTAWEQVAFFLFLSLSVYTIFPLSFWWAMIFGI
GATMCHIIIISVIVSVSRPRPKDVEVQVVANVVLFVCINCVGLFHLWLTENARRKSTMSR
ETFSYNRSKRATQKRDQEHLLLSVLPRYIAMELKGEVVKGLSRTFTGPDNKPNFHNLYVK
QHKDVSILYADIVGFTSLASTCTPEELVIVLNKLFGKFDDLAKKNECLRIKILGDCYYCV
SGLPDPIPHHARNCVQMGLNMCTSINKLREATGVDISMRVGVHSGNVLCGVIGLLKWQYD
VWSNDVTLANRMESGGVPGRVHITEETLGNLGGAYQVEEGNGASRDSALEGRKTYLVIDP
NTQNSTDTKPKTNFLAMNGRPKQRASVRMSQYLQSWKSINPFSELNRSEDTITVPLSTSN
DFSQSLGDTESVRHPPYTSNQESRRSFVSENGSMASLDPLDVSGSKMKKLNWLTLFFCDI
NMEKQYRLSEVKDVHQSAACLALVFTAIFIVQMLTSQKNTPLAISYGVTFPVQLLLLVVI
SVGFLKQWNSKIPPSIKWMSLLPYGVVTKAVLRLLLVFTCLLITLLMAILNIVFIPGDKC
LDSPNNATTLDYLNLYSVPYYLYCCLLAMLAVVVFVRLSFSVKFFLLTLALVVYLALFLY
VYAPRSDCYMLQLYNNSNPGVLKEPKIMSGIWLCIFYFASLILARQDELACRVEFLLQKC
FEKEREEMETTENVNKLLLENLLPSHVTNFFIGKTVPNQDLYSQSCEAVCVMFASVPEFK
NFYTESNENGDGLECLRFLNEIITDFDELLIKPKFNVVEKIKTIGTTYMAAAGLTNPTTG
EERKVRLQKSINGKDSDACKNNVRSMVDFAMALMGRLEYINRHSFNDFKLRIGINHGPVI
AGVIGAHKPQYDIWGNAVNVASRMDSTGILNKIQVTEETAQVAQSIGFIVTKRGVVHVKG
KGQLTTYFINTEPSSQHP
NT seq 3657 nt   +upstreamnt  +downstreamnt
atgaaaactagtataagaaaacagaaagaacactgggtcactatgcaggatgactcacat
gattgccttgaaatgatcaccaaatatcctgaggacttgtcacaacaaaaaggggatata
aaccaaataagaaaacagagtaagcatgaaggaatacagaaagccaataaatctgcccag
gatggggataaacaaccgactggtagtggaatcaggcagcacaacattgagctaggaatt
gctaagaaggagaacaccccagaacctcttcaagcatgcacatcttttaggacatccaat
acaaccacaaatggccctgcatacccatcacttcctgaagccattatggaagacaacact
aacagtggtctagggaactgcttacaatcctgcagaactgatcatgattgtacagaagca
gagccagatgtcatgggagtccctgagcgtcaaagtgtgagaattcggcgcactactgcc
acaggtgcatgccgttgttaccaagcagtgcggctaggatttctgcagtgcctggaggac
accccgtttgtggtaccaggcctggtattgaccatcttgttttgtgtgaccatcatcgtc
atcattgctgctactggcagacatatcactggttatgtcggagcattatcagtggtgtgt
gtggtgctctgtctttgtgtcccgctgttggtgtgtttgccatgcctgcccaccttgcgc
aggtgtgaacagatgcttgcgctctccatctggttcatgctattcatcactgccattgtc
ttcatcttcaccgacaaagtcgtcacagcatgggaacaagtagcattttttctctttctc
tctctatcagtatacacaatctttcctcttagtttctggtgggctatgatctttggtatc
ggagccactatgtgtcacatcatcatcatcagcgtcatcgtgtctgttagccgccctagg
ccaaaagatgtggaagtgcaagtggtagcaaatgtagtactgtttgtgtgtatcaattgc
gtgggtctttttcacctctggcttactgagaatgcacgcagaaagtccaccatgagccga
gaaacctttagctacaaccgttccaaacgagccacacagaaacgtgatcaggaacacctc
ctcctgtctgtgctgccacggtacattgctatggagctcaaaggggaggttgtcaaaggt
ctgtcgagaacattcacaggacccgacaataaaccgaacttccataacttgtatgtcaag
caacacaaagacgtcagcattctgtatgcagacattgtaggtttcaccagcctcgctagc
acctgcactcctgaggaacttgtcattgtccttaacaaactcttcggcaagtttgatgac
cttgccaagaaaaatgaatgtctacgtatcaagattctgggtgactgctactactgcgtt
tcaggccttccagatccgatccctcaccacgcacgcaactgtgtacagatgggtctgaat
atgtgcacttccataaacaagctgagggaggcaacaggtgtggacatcagcatgagggtt
ggtgtgcactcaggaaacgtgctttgcggggtaattggcttgctcaagtggcagtatgac
gtctggtcaaatgacgtaactctagccaatcgcatggagtctggaggtgttccgggaagg
gttcacattacagaagagacccttggaaacttaggtggggcataccaagttgaggagggg
aacggagccagtcgggattctgctttggagggcaggaagacgtatttagtgattgacccc
aacacacagaacagcactgatacaaaaccaaagaccaacttcctggcgatgaatggtaga
ccaaagcagcgggcttcagtgagaatgtctcagtatctacagtcctggaagagcatcaac
ccattttcagagctcaatcgatcagaagacacgatcactgtcccactcagcacatcgaat
gacttcagtcagtcattgggggacacggaatcagtaaggcatccgccatatacttccaac
caagaaagcaggcgttcatttgtgtcggaaaatggatcaatggcgtcactggacccacta
gatgtttcaggatcaaaaatgaagaaactcaactggttgacactgtttttctgtgatata
aacatggagaagcagtatcggctgagcgaggtaaaggatgtccatcagtctgcggcctgt
ctcgctcttgtcttcactgccatattcattgtacagatgcttacctcgcaaaaaaataca
cctctggcgatatcatatggagttacctttcctgtccagttgctgttactggtggtgatc
agtgtgggatttttaaagcaatggaactctaagatcccgcccagcattaaatggatgtca
ttactaccatatggagtagtcaccaaggcagtgctgagactactcctggtcttcacctgt
ctccttatcacactacttatggccattctgaacatagtgtttattccaggtgataaatgc
ctagactcccccaacaatgccaccactctggattatttaaatctctattctgtaccgtat
tatctgtattgctgtttactggcgatgctggcagtggtggtgttcgtacgcctgtctttt
tccgttaaattctttctcctcacacttgcactagttgtctacctcgctctcttcctgtat
gtgtatgcaccacgttctgattgttacatgctgcaactctacaacaattccaatccggga
gttctaaaggagcccaagatcatgtcaggcatttggctctgcattttctacttcgcctct
ctaattcttgcccgacaggacgagctggcctgtcgagtcgagttccttctacagaaatgt
tttgagaaagagcgtgaagagatggagacaacagaaaatgtcaacaagctcctcctcgaa
aatctgctgccttctcatgttaccaatttctttattggcaaaactgtacccaaccaggac
ttgtacagtcagtcttgtgaagctgtgtgcgtgatgtttgcctcggtacctgagtttaag
aatttctacacagagagcaatgaaaatggagatggcctggagtgtctgagattcctcaat
gaaatcatcacagactttgacgagctcctaatcaagcccaaattcaatgtcgttgagaaa
attaagactattggcaccacatacatggctgctgctgggctgaccaatcccaccacaggg
gaggagcgaaaagtaagactgcaaaagtcaattaatggaaaggacagtgacgcatgcaaa
aataatgtgcgaagtatggtggactttgccatggctttgatgggaaggttggaatacatc
aacagacactctttcaacgacttcaaactcaggataggaataaaccatggccctgtcatt
gctggggtaattggagcccataaacctcaatatgatatctggggaaatgctgtgaatgta
gccagcagaatggacagcactggcatactgaataaaatacaggtgactgaagaaactgcg
caggtggctcaaagcattggcttcatagtaactaagagaggtgtagttcacgtgaaaggc
aaaggacagcttaccacttacttcatcaacactgagccctcatcacagcacccataa

DBGET integrated database retrieval system