KEGG   Ictalurus punctatus (channel catfish): 108261241Help
Entry
108261241         CDS       T04658                                 

Gene name
kcnk2
Definition
(RefSeq) potassium two pore domain channel subfamily K member 2
  KO
K04913  potassium channel subfamily K member 2
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ipu04040]
    108261241 (kcnk2)
Ion channels [BR:ipu04040]
 Voltage-gated cation channels
  Potassium channel, two-pore domain (K2P)
   108261241 (kcnk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans_2 Ion_trans bZIP_Maf DUF1616
Motif
Other DBs
NCBI-GeneID: 108261241
NCBI-ProteinID: XP_017317630
UniProt: A0A2D0QJ80
Position
2
AA seq 428 aa AA seqDB search
MAAPDLLDPKAAAHNSKPRLSFSAKPVVLNTQDDFEPRVSVMRWKTVLTVFLLVVLYLIM
GATVFKALEQPHENSQKLAILSQKLQFLIDHPCVNSTELEELVKQVMSAIRAGVNPSGKS
SNVTSLWDLSSSFFFAGTVITTIGFGNISPHTEGGRIFCIVYALLGIPLFGFLLAGVGDQ
LGTIFGKGIAKVEKMIVKWNVSQTKIRVISTVLFILFGCLLFVTLPAIIFKHIEGWSALE
AIYFVVITLTTIGFGDFVAGEGERRHHQESNGGLEMEYLDYYKPVVWFWILVGLAYFAAV
LSMIGDWFRVISKKTKEEVGEFRAHAAEWTANVSAEFKETRRRLSVDIYDRFQRAASIKR
KLSAELGLNNVPMNQEMTPGKRARSVNLGDDREMYPAFTLAHNGSLFLNGLSPEYADRRD
IAIIEHLK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggccgctcctgatcttctggaccccaaagctgctgctcacaactccaagccccgcctg
tctttctctgccaagccggtggtgttgaacactcaggatgactttgagccccgcgtgagc
gtcatgcgctggaaaaccgtgctcaccgtcttccttctggtcgtcctctaccttatcatg
ggagccaccgtgttcaaggcgctggagcagccgcacgagaactcgcagaaactcgccatc
ctcagccagaagcttcagtttctcatagatcacccttgcgtcaactccaccgagctggag
gagttagtgaagcaggtgatgtcagccatccgagcgggcgtgaacccttctggaaaatcg
tccaatgtgacaagtttgtgggatctgagcagctccttcttctttgccgggactgttatc
accactataggcttcgggaacatttcccctcatacggaaggaggcagaatattctgcata
gtgtacgcgctgctgggaatccctctgttcggcttcctgctggcgggagtgggcgaccag
ctggggaccatattcggaaagggcatcgctaaagtggagaagatgattgtgaagtggaac
gtgagtcagacgaagatccgtgtgatctccacggtgctcttcatcctcttcggctgcctc
cttttcgtcacgttgccggccatcatcttcaagcatattgaaggctggagcgccctagag
gccatttactttgtcgtcatcaccttgacgaccatcggctttggcgattttgttgcaggt
gagggcgaacgccgtcaccaccaggagagcaacggtggcttggagatggaatacctggac
tactataagccggtggtatggttttggattctggtgggactggcctacttcgccgcagtg
ctcagtatgatcggagactggtttcgggtaatctcaaagaaaacgaaagaggaggtgggc
gagttccgagcgcacgctgccgagtggacagccaacgtttctgccgaattcaaagagacg
cgtcgtcgcctcagcgttgacatctacgacaggttccagcgtgccgcttccatcaagcgc
aagctctcggccgagctcggcctcaacaacgtgccaatgaaccaggagatgacgccgggc
aagcgggcacgctccgtcaacttaggagacgacagagagatgtatccagccttcacgcta
gcacacaacggcagcctgttcctcaacggcctcagcccggagtacgccgaccgccgtgac
atcgccataatagaacacctgaaatga

DBGET integrated database retrieval system