KEGG   Ictalurus punctatus (channel catfish): 108261592Help
Entry
108261592         CDS       T04658                                 

Definition
(RefSeq) 5-beta-cholestane-3-alpha,7-alpha-diol 12-alpha-hydroxylase-like
  KO
K07431  sterol 12-alpha-hydroxylase [EC:1.14.18.8 1.14.14.139]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00120  Primary bile acid biosynthesis
ipu01100  Metabolic pathways
ipu03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    108261592
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    108261592
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ipu00199]
    108261592
Enzymes [BR:ipu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.139  5beta-cholestane-3alpha,7alpha-diol 12alpha-hydroxylase
     108261592
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.8  7alpha-hydroxycholest-4-en-3-one 12alpha-hydroxylase
     108261592
Cytochrome P450 [BR:ipu00199]
 Cytochrome P450, animal type
  CYP8 family
   108261592
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 108261592
NCBI-ProteinID: XP_017317915
UniProt: A0A2D0QK01
Position
Un
AA seq 512 aa AA seqDB search
MSFLLQILLALFISLLGGLYLLGAFRRRRSGEPPLDKGPLPWLGHVLEFRRDTAKFLERM
RKKHGDIFTVQLGGFYFTFLTDPLSFGSVVKEARAKLDFSEFAKHLVQRVFGYHPLEDDD
KLIQASTNKHLMGDGLVVISQALMNNLQNLMLHNIGPGNDDDRPWQEDGLFAYCYNIVFR
AGYLALFGNEVGKTAGSVDKAKEVDRKESNELFYEFRKYDQLFPKLAYGVLGPSEKMEAE
RLKKLFCKVLTVEKVNTKENISGWVSESQQMRAERGMHESMLDRYMFILLWASQGNTGPA
SFWLLLFLMKHPEAMKAVKSEVDEVLHETRQEVKRGGPLINLTRDMLLKTPVLDSAVDES
LRMTAAPVLTRAVLEDMSLKMDNGHEYKIRKGDRVSLFPYTAVQMDPEVHPDPLTFKYNR
FLTPDGRKKTEFYKGGKKVKYYNMPWGAGVSMCPGRFFAINELKQFVFLMLTYFDFELKN
PDEEIPDIDVRRWGFGMMQPTQDIPFRYRLRF
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgagctttctgctgcaaattcttcttgctttgtttatctctctgcttgggggactttac
ctccttggagcctttcgtcgtcgaaggtctggagaacctcctctggataaaggtcctcta
ccatggctgggacacgtcctggagttcaggagggacactgcaaagtttctagagaggatg
agaaagaagcatggggatattttcactgtgcagctgggagggttttatttcactttcctc
acagacccactgtccttcggctcggtggttaaagaggcccgggccaaactggactttagc
gagttcgctaagcacctggtccagcgtgtttttggttaccatcccttagaagatgacgac
aagctcattcaggcatccaccaacaagcatctgatgggtgatggcctggtggtgatatca
caagccctgatgaacaacctacagaacctcatgttgcacaacattgggcctggaaatgat
gatgaccgaccgtggcaggaggatgggctcttcgcttactgctataacatcgtgtttcga
gccggatatctggcgctttttggaaacgaagtaggcaaaactgcaggaagcgtggataaa
gcaaaggaagttgaccgaaaggagtcaaatgagctcttttatgagttccgtaaatatgat
caacttttcccaaagctggcctacggagttctgggaccttctgagaaaatggaagcagag
agactgaagaagcttttctgtaaagtcctcactgtggagaaggtgaacaccaaagagaac
attagcggctgggtatctgaatcacagcagatgcgtgccgagcgtggaatgcatgagtcc
atgctggacagatacatgttcatcctcctgtgggcgtcgcagggtaacacaggtcctgca
tcattctggcttcttctcttcctcatgaagcacccagaggccatgaaagcggtgaagagc
gaggtcgatgaggttctgcatgaaaccagacaggaagtgaagcgtggtggcccgctgatt
aacctgacccgagacatgcttctcaaaaccccggttctggacagtgcagtggatgagagc
ctgcgcatgacggctgctcctgtgcttacacgagccgttctggaggacatgagcctgaaa
atggacaacggccacgaatacaagatccgcaaaggtgaccgtgtgtccctcttcccctac
actgctgtccagatggacccagaggtgcaccctgatccactcaccttcaagtacaaccgc
ttcctcacacccgacggcagaaaaaagacagaattctacaaaggaggaaagaaagtgaag
tactacaacatgccgtggggtgccggggtcagcatgtgtcccgggaggttcttcgccatc
aacgagctcaagcagttcgtcttcctcatgctcacatattttgactttgagttgaagaac
ccagatgaagagatcccagacatcgatgtgaggcggtggggattcgggatgatgcagcca
acgcaggacatcccattcagatacaggctcaggttttag

DBGET integrated database retrieval system