KEGG   Ictalurus punctatus (channel catfish): 108263165Help
Entry
108263165         CDS       T04658                                 

Gene name
abhd12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ipu01002]
    108263165 (abhd12)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ipu04147]
    108263165 (abhd12)
Enzymes [BR:ipu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     108263165 (abhd12)
Peptidases [BR:ipu01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   108263165 (abhd12)
Exosome [BR:ipu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   108263165 (abhd12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 Peptidase_S9 Abhydrolase_2 Peptidase_S15 Thioesterase Abhydrolase_3 Lipase_3
Motif
Other DBs
NCBI-GeneID: 108263165
NCBI-ProteinID: XP_017319175
UniProt: A0A2D0QNZ9
Position
3
AA seq 359 aa AA seqDB search
MRRRVDETAASKRTEGKSVKRETGEVQTKTKSSWWVWVKRGLIALCTLYVATPFILQFFP
SVIQYLVYKHAVTYFVDLRRPCDLGLNHTVNMYLTSEAGVTLGVWHTVPEQKWKEAQGKS
LAWYEQSLGDGSPVFIYLHGNTGNRAAPHRLGVANVLSALGYHAVVMDYRGFGDSTGEPT
EAGLTTDTLYLYHWVRARSKDSLVIIWGHSLGTGVATNTAVKLHEQGNPADAVILEGAFT
VAEMPKGYPHPFTWYYWRFPYIQYYFSQDSIKANKFVLPNVQNLKKMTTPLMILHSKDDH
MAPFRMAEELYNTAKSVLKSENKVRLVAFDGSHGYLHNGLYRDPALPNYIREFVLSVAK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgagaaggagagttgatgaaactgctgcgtccaaacgcactgaggggaaatcggtgaaa
agggaaactggtgaagtgcaaaccaaaaccaagtcatcatggtgggtgtgggtgaaaagg
ggactgatagccctttgcactctgtatgtggccacgccatttattctgcaattctttccc
agtgtcatacaatacctggtttataaacacgccgtaacatactttgttgacttgaggcgt
ccctgtgatcttggtctcaatcacaccgtcaatatgtacctgacctcagaagcaggagtg
acactaggagtatggcacacggttcctgaacaaaagtggaaggaggctcaaggtaaaagt
ttggcgtggtacgagcagtctttgggggatggttcccctgttttcatctacctccatggc
aatacgggcaacagagcagcgccacatcgtttaggagttgccaatgtgttaagtgctctt
ggctatcatgctgtggttatggattacagaggattcggggattcaaccggagagcccacc
gaggctggattaaccacggatacactttatctgtaccactgggtacgggcacgcagcaag
gacagtctggtcatcatatggggtcactcccttggcacaggagtggcaactaacactgca
gtgaaactacatgagcaaggaaaccctgctgatgcagtgatacttgaaggtgctttcaca
gttgcagaaatgcccaaaggatacccccatcctttcacctggtattactggagatttcca
tacatacagtactacttttcccaggactctattaaagcaaataaatttgtattgcccaat
gttcaaaacttgaaaaaaatgacaactcctcttatgatccttcattctaaagatgaccac
atggctcctttcaggatggctgaggagctttacaacactgctaaaagtgtgctgaagtca
gagaataaagtcagactggtggcatttgatggatcccatggatatcttcataatggactt
tatagggatcctgcactgccaaattatataagggagtttgtgctgtcagttgcaaagtaa

DBGET integrated database retrieval system