KEGG   Ictalurus punctatus (channel catfish): 108264368Help
Entry
108264368         CDS       T04658                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108264368
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ipu04030]
    108264368
G protein-coupled receptors [BR:ipu04030]
 Rhodopsin family
  Lipid
   Leukotriene
    108264368
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 DUF5083
Motif
Other DBs
NCBI-GeneID: 108264368
NCBI-ProteinID: XP_017321316
UniProt: A0A2D0QUA9
Position
4
AA seq 355 aa AA seqDB search
MFTQPSRGTTVNSTLKQSVYSWLYHCLTMRYLNFSLNQTSESDFLITNGTVGYKQVGAAV
FLSMCCLVGLPSNIAVIITIARQWNRRMSFTLKLMLNLAISDSLVLTLAPFGVSGLLYGW
TFGLWSCKILMYLVYCAMYASVLTVTLMAAHHYHTIKSKVADLSALERLQKVRRHLLLIG
LWSLATVFALPILFIQNVQFKRGSSRCQRTITSHSGKVTVLVLEVLFGYVLPFSIIAASY
CWICKTQLQGGKNIRERKQRMRRLVISIVTAFFLFWTPVHVINMIDIATTLTKASSPAVY
TQLKLIRRATGDLSKTVCVLNCCVNPFLYAIASGIFRKKRHHHETENNTDITVTN
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgttcacacaaccttcaaggggaacaactgtgaactccactctgaaacaaagtgtttat
tcttggctgtaccactgcctgaccatgaggtatcttaactttagccttaatcagacttct
gagtctgattttctcatcaccaacggtactgtgggctacaaacaggtaggcgctgctgta
tttctaagcatgtgctgcttggttggattgcccagcaacattgcagttatcatcaccatc
gctcgtcaatggaacagacgtatgagtttcactctgaagctaatgctaaacctggctata
tctgattctttggttctcactctggctccttttggagtttctggtttgctgtatggatgg
acttttggcctttggtcatgcaaaattctgatgtatctagtctactgtgctatgtatgct
agtgtgttgactgtgactttgatggctgcacatcactaccacacaattaagtcaaaagtt
gctgatctcagtgcactggaaagactgcagaaggtgcgtagacacttactgttaattggg
ctctggagtttagccacagtttttgccttgcccattcttttcattcaaaatgttcaattc
aagaggggatcttcaaggtgccagaggaccataacatcacactctggaaaggttacagtt
cttgtgttagaggtcctgtttggatatgtcctccctttcagcattatagcagcatcttac
tgctggatctgcaagacacagctacaaggagggaaaaatattagggaaaggaagcagaga
atgagaaggcttgtaatcagtattgtcacagccttctttcttttctggacacctgtacat
gtcatcaacatgattgacattgctactactctaactaaggcatcgtctccagctgtctat
actcagctgaaattgattcgcagagcaacgggagatttgagcaaaactgtctgtgtactt
aactgctgtgtgaacccttttctgtatgcaattgcatcagggatcttcaggaaaaagagg
catcaccatgaaacagaaaacaacacagacattactgtaacaaattga

DBGET integrated database retrieval system