KEGG   Ictalurus punctatus (channel catfish): 108264581Help
Entry
108264581         CDS       T04658                                 

Gene name
tiparp
Definition
(RefSeq) TCDD inducible poly(ADP-ribose) polymerase
  KO
K15259  poly [ADP-ribose] polymerase 7/11/12/13 [EC:2.4.2.30]
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    108264581 (tiparp)
Enzymes [BR:ipu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     108264581 (tiparp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP WWE Torus
Motif
Other DBs
NCBI-GeneID: 108264581
NCBI-ProteinID: XP_017321715
UniProt: A0A2D0QW56
Position
4
AA seq 638 aa AA seqDB search
MEKSLGMMLEAEDGRSGAKVLGSLAMGDGEFADRRIGLVDKIPLVKPYFKKKHAQRKLDA
KCLRALEDPILSTILGSDDLVAGDGVFVPRNPPPASAQPSLMCAAAVAEDARADATAEEL
AAGEQKATGATRDSSEASPRDDASAAARTSALEVAVKAAANGAEPSAVARGGHGELFRDK
SDEASLDLVFELLMQLQYHTRQDDAVHICVDFLRGACLCGSECARHHTALPYHWQIRRAD
TRVWQSVSEDAQEQLERLYCNPDNDQVRLKFLGRVFMLDFSAMRVCDMEFDLVRRLSTPS
SFGAVDPGTSPASSTNPAPNYLTVWKYYCRDNFGWREYSEPVVRLIEEATERGLKEVRFI
TLQNQYILNIREGFQQNAVFGFRRQIKKRPHFMSSIRLSPYLQTLGGLCTLEVAGPQPLS
PTSTQGPRLFPETWVPMNPEQDFMQVPVSREDRSYRTVYNLFHKTVSETKFRILKILRVQ
NPFLWEKYKRKKEYMSRRMSETERLLNERHLFHGTSQDVVEGICKHNFDPRVCGKHATMF
GQGSYFARRAAYSHSFARRSPRGLHYMFLAKVLTGKFTVGNPGMRRPPPLCPRQPAGDLF
DSCVDNCVDPQIFVIFNDDQCYPYFIIQYEEVANTVAI
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaagtttaggcatgatgctggaagcggaagacggaaggagtggagctaaagtg
ttgggaagcctggccatgggcgacggggagttcgcggatcggaggatcgggctcgtggac
aagatcccgttggtgaaaccctatttcaagaagaagcacgcgcagaggaaattagacgcg
aagtgcctgcgggcgctcgaggaccccattctgagcacgatactcggctcggacgacctg
gtggccggagacggcgttttcgtgccgcggaatccgccgccggcgtccgcgcagccgagt
ctgatgtgcgccgcggccgtggcggaggatgcgcgcgccgacgcgacggcggaggagctc
gcggcgggcgagcagaaagcgacaggcgcgacgagggactccagcgaggcgtctccgcgc
gacgatgcgtcggcggcggcgcggacctccgcgctcgaggtggcggtgaaggcggctgcg
aacggtgccgagccgtcagccgtcgcgcgtggaggacacggagagcttttccgcgacaag
agcgacgaggcctctttggatctagtgttcgagctgctcatgcagctgcagtatcacacg
cgccaggacgacgccgtgcacatctgcgtggatttcttgcgcggcgcgtgcctgtgcggc
agcgagtgcgcgcggcaccacaccgcgctgccgtaccactggcagatccggcgcgcggac
acgcgcgtgtggcagagtgtatccgaggacgcgcaggagcagctggagagactctactgc
aacccggacaatgaccaagtccgccttaaattcctgggtcgagtgtttatgctggacttc
agtgccatgagggtgtgtgacatggagttcgacctcgtcagacggttgtccacaccttcc
agcttcggagccgtggaccccggcacaagccccgcctccagcacaaaccccgcccccaac
tatctcacagtgtggaaatattactgcagggataacttcggctggagggagtactccgag
cctgtggtgcgtttgatagaggaagcgaccgagcgggggctgaaggaggtgcgcttcatc
acactccagaaccaatacatcctgaatatccgcgagggcttccagcagaacgccgtcttc
ggtttccgccgccagatcaaaaaacgaccccacttcatgtcctccattagactctcgccc
tacctacagactctcggaggtctctgcactctagaagtcgccgggccgcagcccctgtcg
cccacgtccacccagggacctcggcttttccccgagacgtgggttcccatgaaccctgaa
caggactttatgcaggtgccggtgtcgcgcgaggaccgcagctaccgcaccgtctacaac
ctcttccacaaaaccgtgtccgagaccaaattccgcatcctgaaaatcctccgcgtccag
aatccgtttctctgggagaaatataagaggaagaaggagtacatgtcgcggcgcatgtcg
gagacggagcgcctgctgaacgagcgtcacctgttccacggcacctcgcaggatgttgta
gagggcatctgcaagcacaacttcgacccccgcgtgtgcgggaagcacgccaccatgttc
ggccaggggagctacttcgcgcgtcgggcggcgtactcgcacagcttcgcgcgccgctcg
ccgcgcggcctccactacatgttcctagccaaagtgctgacgggaaagttcacggtgggg
aacccgggcatgcgccggccgcccccgctgtgtcctcgccagcccgccggagacctcttc
gactcgtgcgtggacaactgcgtagacccgcagatcttcgtcatcttcaacgacgaccag
tgctatccgtattttatcatccagtacgaggaggtggccaacaccgtcgccatctga

DBGET integrated database retrieval system