KEGG   Ictalurus punctatus (channel catfish): 108264692Help
Entry
108264692         CDS       T04658                                 

Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha-like
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00562  Inositol phosphate metabolism
ipu01100  Metabolic pathways
ipu04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    108264692
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    108264692
Enzymes [BR:ipu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     108264692
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3K_rbd PI3K_C2
Motif
Other DBs
NCBI-GeneID: 108264692
NCBI-ProteinID: XP_017321937
UniProt: A0A2D0QU42
Position
4
AA seq 1012 aa AA seqDB search
MDQISSGNGYEMDSSATFIVVRPKGPVGKDEALRMEVDALDKMQHDQRHKIQDHASHMKA
QPNAQASLTSLSQLEKDLIIFPDSDPKKESEDDTFSDINVEALTNKELEKLLLDDNFGRP
PSLLRHNLSASDTGGQAFSSHPLHWTSLLSTSKSTMPTLTHLQGPVFPFQSVHFPAQQST
FIPFLSVQPVSPQVFHQPVISPEMAQLFDKIASTSEYLRNGRSSIMAENSVSIKSLEPVL
HPTDSSSISHFDWLDLDPLSKHRVEVEEIPGAISGPVIVDSVPASDPWDAVLQEETEVKM
SNSYLAQEKDNYTVTPQPRRASTGMAVTKNHIPATSFLHSQSKQVTNESGNALGKSAILQ
ENWGQNFEVLAFCEDIAKLKAKFPFDDHSTNPGYVLSPVISHREVGGDNSSSVKVSIEIL
DSQQPVTFTCDVSSPVELLIMQALCWAHDDLSQVDISSYVLKVCGQEQVLQNKHSLGSHE
YVQNCRKWETEIKLQLLTRNTMKRDLARTEEDDASPIDLEKYLRDIEMPFKKTVTRESFA
EHLEEYHSQVNICLQNESTKYKAVDQVIHVVKTLCYLLDEVETPAITDAVRKLRHSVNLP
KTCSTEVNARSAFSTNGYTSAVEEHLRALTNAVYDLVKLYLCSFCLTFPVRTDEEHLEKQ
RDSQVASSITEHVHFKLFAIHGISTAWFNSYEKYFMMCALMHNDGNLLKPVKSKKVGIYR
SFFYHIKWDELINFPISVALLPLETVLSLSLYGVLNQNSTNSPDSNKQHKGPELLGKVIM
PLFDFRRVFARGTKLLSMWTSPPLSLPGPVGKSKNLEERIILQIDLPNPQVDVLYVSPLE
ATLPDLQSLEMPEPDIRKRIEKLCTLASSSRLTQGDMQLLWDQRYYCQRHEHSLPKILAS
APSWDWISIAEIHKLLHHWPPLSPVCALELLDSKFADTEVRAMAVSWIEICSDDELTDYL
PQLVQVPINSMQNVTIALSHFCIFLICNITSIIHCLFSGADKHFFTFLPSRL
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
atggaccagatatccagtggcaatgggtatgagatggacagttcagccactttcatagtg
gttcggccaaagggaccagtggggaaggacgaggctttgcgcatggaagtagatgcattg
gataaaatgcaacatgaccagagacacaaaatccaagaccatgcatcccatatgaaagcg
cagcctaatgcacaagcatctttaacgtccctcagccagctggagaaagacctcattatc
ttccctgactcagaccccaagaaggagtcagaggacgacaccttttcagacatcaatgtg
gaggcattgacaaataaggagttggagaagctgcttttggatgataactttggcaggcct
ccatctctgttgcggcacaacctcagtgcatcagacacaggtggacaagctttcagttcg
catcctttacactggacatccttgctttccacttcaaaatccactatgcccactctgaca
cacctgcagggcccagtctttccttttcagtctgtccactttcctgcccaacagagcact
ttcatcccttttttgtcagtccagccagtcagtcctcaggtctttcatcagccagtcatc
agcccagaaatggctcagctctttgacaagattgccagcacttcagaatacttgaggaat
ggcaggtcttccatcatggctgaaaactctgttagcatcaagtccctggagcctgtactc
caccctactgattcctccagcattagccactttgactggctggatctggaccctctcagt
aagcatcgagtggaggtagaagagattcctggtgcaatatctggaccagtaatagtggac
tctgtgcctgcaagtgacccctgggatgcagtgttgcaggaggagaccgaggtcaagatg
agcaacagttatttagcacaggaaaaagataactacactgtaactcctcaacctagaagg
gcatctacaggaatggcagttaccaagaaccacattcctgcaacctccttcctgcacagc
cagagtaaacaagtcactaatgaaagtgggaatgcactcggaaagagtgccattttacaa
gaaaattggggccagaatttcgaagtcttagcattctgtgaagatattgcgaaactaaaa
gcaaagtttccatttgatgatcattctaccaatcctggatatgttttgagtccagtgatc
tctcacagggaggtagggggagacaatagtagcagtgtgaaagtttccattgaaattttg
gactcccagcagcctgtaaccttcacctgcgatgtgagttcaccagtggagctactgata
atgcaggcactctgctgggctcatgatgacttgagccaggtggacatcagcagctatgtc
ctgaaggtctgtggccaggaacaggtcctacaaaataaacacagtctgggcagccacgag
tatgtacagaactgcaggaaatgggagactgagataaagctgcagctccttactcgcaac
accatgaagagagaccttgcccgaacggaagaagatgatgcctcacctattgacttggag
aaatacctacgtgatattgagatgccttttaagaaaacagtcacaagagagagctttgct
gaacatttagaggaatatcacagccaagtcaacatctgccttcagaatgagagcacaaag
tacaaagcagtggatcaagtaatccatgtggttaaaactctgtgttatttgctggatgag
gtggaaacaccagccataactgatgctgtgcgaaaactgaggcattctgtcaaccttcct
aaaacttgctcaacagaggttaatgccagatcagcattttcaactaacggttatacaagt
gcggtggaggagcacctaagggcccttacaaatgcagtatacgatttggttaagctctac
ctgtgctcattctgcctgaccttccctgtacgtacggacgaagagcatctagaaaagcag
agagacagccaagtggcgtccagcatcactgagcatgtacacttcaagctttttgccatt
catggcatttccactgcatggtttaacagttatgaaaaatacttcatgatgtgtgctctg
atgcacaatgatgggaatcttttgaagcctgtcaaatccaagaaggttgggatatacagg
agcttcttctatcacatcaaatgggatgaactgataaactttcccatctctgtcgccttg
ttacctctggagaccgttttgagcctctctctctatggagttctcaaccagaattctact
aactctcctgattccaacaaacagcacaaggggccagaactgttaggcaaagtcatcatg
cctctctttgacttcaggcgggtgtttgctagagggactaagctgctgagtatgtggaca
tctcctccattgtccttgcctggacctgtgggaaagagtaagaacctggaagaaagaatc
atactgcagatagatttacccaatccacaagtggacgtgctatacgtaagtcctctggag
gcgactttacctgaccttcagtctctagaaatgcctgaaccagacatccggaagaggatt
gaaaagctctgtacactggcatcttcttccagactgacacagggagacatgcagctgctt
tgggaccagcggtactattgccaaagacatgagcacagtcttcccaagattttagccagt
gcacccagctgggattggattagcattgcagagatccacaaactcctacaccactggccc
ccactctctcctgtgtgtgccctagaattgctagattcaaaatttgccgatacagaagtt
cgggccatggctgtgagctggattgagatctgcagtgatgatgagctaactgactacttg
cctcagcttgttcaggttcccattaacagcatgcaaaatgttaccatagctttatcccat
ttctgcatttttctcatctgcaacataacatctataatccattgtctgtttagtggtgct
gataaacattttttcaccttcctaccctcaaggctctaa

DBGET integrated database retrieval system