KEGG   Ictalurus punctatus (channel catfish): 108265332
Entry
108265332         CDS       T04658                                 

Gene name
adamts13
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ipu01002]
    108265332 (adamts13)
Enzymes [BR:ipu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     108265332 (adamts13)
Peptidases and inhibitors [BR:ipu01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   108265332 (adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_4 Reprolysin_3 Reprolysin_5 TSP1_spondin TSP1_CCN Reprolysin_2 Pep_M12B_propep ADAM_spacer1 Peptidase_M10 Peptidase_M66
Other DBs
NCBI-GeneID: 108265332
NCBI-ProteinID: XP_017323024
UniProt: A0A2D0QXJ3
Position
5
AA seq 1545 aa
MAALMSLFLASVLVDTAFLTTQISLEKDFLQSLAPEDIFHYFGTNSTTLIPEFELVWVSC
FRDESGGKHCSFQAQGKDFKLRWRNEPSLSFPSNLELAINATLSVIKRRDNKCCKQLHVL
KPEDARSFLSVCDGKLQGLLLLQSGKLHVHPLFHKHSDHLRNTVVTPPGVPHLLLPHPSP
VRTYLQQSQSHRRLQRSFPGAEVTHLELLVVVGPDVHEVHKQDTEKYILTNLNIASELLR
DVTLGANIRVHLIRMIIFTEPEPDIQISDDITSSLRSVCEWGHKVNPSTETDPLHADLLL
YITRFDLVLPSGNKQVRGVTQLGGVCSSQWNCVITEDTGFDLGITIAHEIGHSFGINHDG
AGNTCSTGGFIMGTDGGYNSVDLTWSQCSRDQLLNFYSAGKAECVKDVPVLGGSLQEWKP
GLYYGVDDQCRIAFGSTATACSFTSNDMAACRFLSCHVIPGDRSTCTRLLVPLLDGTECG
LNQWCLKGRCVSASKLSSSQLVHGSWSSWSEYSSCSRTCGGGITYRKRECNNPRPAFGGR
DCEGEGTEAELCNRKLCESNQQEFMAQQCSDTDHQPLQLSAYSTTAYSWIPAVGFISGDA
QCKLMCRSREQDFMVSRGAQFIDGTRCELDGPVTAGSVAACLKGKCKVFGCDGVLHSGKV
EDVCGVCGGNGSTCHLITGSYTGGEAKEYVTFLVLPVNASQVHINNWNPVFTHMAVLMND
EYIVAGDGDIALNTTHPSPLEENHMIYNLYLTPDLLPHTEELILSGPISDKIHIQVYRKY
GREYGDITSPNISYHYYMPDAESVEKIIEGRWSTVISSCSVTCGSGIQRVSQECVDMNTQ
EHLEEKFCVSVTPKPTALQPCHLPDCPPSWVLGEFGPCSAPCGVGERLRSVACSQKRGME
TVALPDSACSQMTKPAATETCNTQLCSTRWQISEPGDCSAVCGPGEAHRPVSCVRFHLGA
DSEVDESLCLHPKPSERVPCVVDVCPIGWETHGKDQQDHKGSLAVILRSKIIPVYVWSPV
IGHCTKTCGNGTQQIWFSCVDHQSQLDVPEFLCDRFSKPEPYTKLCVQSPCPAMWRYIQG
VCSVSCGGGVARRVLYCSQQAAGGDGGMEEVVADSACLPASRPLKVVPCNTEPCPARWQV
GGQGPCSVSCGLGVALRRASCVQFDGKWDREVEDERCEEGKKPPLTVPCFTQACSFHWGV
QEWSECSVSCGYGIQSRTVSCLGPSSPLPITPILCVHLPKPITIQACYYSTNCSTPAPST
APTGEPEAWSKKSAWKLFHEEKRTTSAPAGDTEKFSEVLPTVPVLRSTSTLSTQPPQSSL
CGQLLLQATGIIDLRNVSERRCFISIGRPLDEVIQIKIESSSLNCRHKENLALYERKSLR
QICEKMPGKTLISRSNVLLVRQNRLTPGNGVLLSYQSKKNMKKSHREDCDVQLFSSSGLI
ENPVRSSSSSSSSMQSCRVFIDAPPALRIQIRALSVFNATSSDSAYVLIRDVDAVKTAVF
QGTQLFHWSSTGSRAEVEFHGEYQHIKGTFRAEYSYIKPEEAKLM
NT seq 4638 nt   +upstreamnt  +downstreamnt
atggccgctctgatgtcgctctttctggcgtccgtcctggtggacacggctttcttaacg
actcagatttccctagagaaggattttttacagtctctggcccctgaggacatattccat
tattttggcactaattcaacaacattaatacctgaatttgagcttgtgtgggtgagttgc
tttagagatgagagtggtggaaaacactgctcatttcaagcccaggggaaagacttcaaa
ctgaggtggagaaacgagccatccttgtcctttccctccaacctggagctcgccatcaat
gccacactcagtgtaataaagaggagggataataagtgttgtaagcaacttcacgtactg
aagccagaagatgctagatcttttctctcagtgtgtgatggaaaacttcaaggcctgctt
ctcttgcagtctggaaagcttcacgttcatccactgttccataaacactcagatcacttg
agaaacacggtggtcacacctccaggtgtaccacatctgctcttgccccacccatcaccc
gtgaggacatatcttcaacagtcacagagtcaccgtaggctccagaggtcatttccaggg
gctgaggtcactcatttagagctgctggtggtagtcggccccgatgtccacgaagttcat
aagcaggacacagagaaatacatcctcaccaacctgaacattgcgtccgagctgttacgt
gacgtcactctaggggcaaatataagagtccacttgatccgtatgatcattttcactgag
ccagagccagacattcagatctctgatgacatcacttcctctctgaggagtgtgtgtgag
tggggtcataaagtcaacccttccactgagactgaccctctacatgcagacctgctcttg
tacatcaccaggttcgatttagtcttgcccagtgggaataaacaggtgagaggtgtgacc
cagctgggcggagtctgttctagccaatggaattgcgtaattacagaagatacaggcttt
gacctcggcatcactatagcacatgagattggacacagttttggaataaaccatgatggt
gcaggcaacacatgcagcactggcgggtttataatggggactgatggcggttacaacagt
gtagatctcacctggtctcaatgcagcagagaccagctccttaacttctacagtgcaggc
aaggcagagtgtgtgaaggatgtaccggtgctgggaggatcactgcaggagtggaaaccc
ggactgtattatggtgtggatgatcagtgtcgcatcgcgttcgggagcacagccaccgcc
tgctccttcacaagcaatgacatggctgcctgccgatttctgtcctgccacgtcatccct
ggcgatcgcagcacctgcacccgacttcttgtgccgctgttggacggcactgaatgtgga
ctaaatcagtggtgtttaaagggccgttgtgtatctgcatccaaactgagctcctctcag
ctggttcatggctcctggtcgtcctggtctgaatactcctcctgttcacgcacctgtgga
ggagggatcacgtaccgcaagagagagtgcaacaatcccaggccagcatttggtgggaga
gactgtgaaggagaggggacggaggctgaactttgtaatcgaaagctgtgtgaaagtaac
cagcaggagttcatggcccagcagtgctcagatacagaccatcaaccccttcagctttct
gcatactcaaccacagcctactcatggatacctgcagttggtttcatttcaggtgatgct
cagtgtaagctgatgtgtcgctctcgtgagcaggacttcatggtgagtcgtggggctcag
tttatcgacgggacgaggtgtgaacttgacggccctgtcactgctggttctgttgctgcc
tgccttaaagggaagtgcaaggtgtttggctgtgacggagtgttgcactctgggaaagtg
gaggacgtttgcggggtgtgtggaggaaatggcagcacctgccatcttattactggctct
tacaccggtggagaagccaaagagtatgtcacattcctcgttctgccagtgaacgcctct
caggtccacattaataattggaatccagttttcacacatatggctgtgctgatgaatgat
gaatatatagtagctggagatggggatatagcattaaacaccactcacccttcacctttg
gaggagaaccacatgatctataatctctacctcacccctgacctcctacctcatacagaa
gagctcattctctctggaccaatctcagacaagatccacatacaggtgtatcgcaaatat
ggaagggaatacggagacatcacaagcccaaacatctcctatcattactacatgcctgac
gctgaatctgtggagaagataattgaaggtcgatggtccacagtcatttcatcttgttct
gtaacctgtggctcagggattcagagggttagtcaggagtgcgttgacatgaacactcag
gaacacctagaagagaaattctgcgtctcagttactccaaaaccaaccgccctgcagcca
tgtcacctaccggactgcccacccagttgggtgctgggtgaatttggtccttgcagcgcc
ccctgtggagttggagagcggctgcgttctgtggcctgttcccagaaacggggtatggaa
acagtggcgttgccagattctgcatgctctcaaatgaccaaacctgcggcaacagaaacc
tgcaacactcagctgtgctctaccagatggcaaatctcagagcctggtgattgttcagct
gtgtgtggtccaggcgaggctcacagaccagtgtcctgcgtccgcttccaccttggcgcc
gactcggaggtagacgaaagcctctgtttacaccccaaaccttctgaacgtgtcccgtgt
gtggtggatgtgtgccccattggctgggaaacacacgggaaggatcagcaagaccacaaa
gggtcacttgctgtaatactccggtccaaaataatcccagtgtacgtgtggagccctgtg
atcggccactgcactaagacttgtggaaatggtactcagcagatatggttctcctgtgtg
gaccatcaatcacaactagatgtcccagagttcctttgtgatcgctttagtaaacctgaa
ccgtatacaaagctgtgtgtccagtcaccctgtcctgccatgtggcgctacatacaggga
gtgtgcagtgtgtcctgtggaggtggtgtggcaagaagggtgctgtactgctctcagcag
gctgcagggggagatggaggcatggaagaagtggtagcagactcagcctgtctccctgct
tccagacctctaaaagttgtaccatgtaacactgagccctgtccagcaaggtggcaggtg
ggtggacagggtccatgttcagtgtcctgtggcctgggtgtcgcattaaggagggcctcg
tgtgtccagttcgatggaaaatgggacagagaagttgaagatgagcgttgtgaagaaggc
aagaagcctcctctcacagtgccctgcttcacccaggcctgctccttccactggggtgta
caggagtggagtgagtgttcagtctcttgtggatatgggatccagtctcgaactgtctca
tgccttgggccgtccagtcctctacccatcactcccattctctgtgtccaccttcccaaa
cccattactatccaggcctgctactacagcaccaactgctccactccggctccaagcact
gctcctacaggggaaccagaggcctggagcaagaagagtgcatggaaactcttccatgag
gagaagaggaccacatctgcgccagctggagacacagagaagttctcagaagttctacct
acagtaccagtgttgaggagcacctcaacgttgtcgacacaacctccacagagcagtttg
tgtgggcagctcttgcttcaggctacgggaatcatcgacctacggaatgtcagcgagaga
cggtgtttcatctctattggccgtcctcttgatgaagtcatccaaatcaaaatcgagtcc
agctctcttaattgtagacacaaagagaatcttgccctttatgagagaaagtctctgagg
caaatctgtgaaaagatgcccggaaagacgctgatttcacgatctaatgttctgttggtg
cgtcaaaaccgtctcacccccggcaatggggtgctgctttcctatcagagtaagaagaac
atgaagaaaagccatcgtgaagattgtgatgttcagctgttctcgtcatctggtttgatc
gagaacccagttaggagttcatcatcctcgtcctccagcatgcagtcttgtcgggtgttc
atcgatgccccgcctgcattaaggatacagatcagagcgctatctgtatttaatgcaacc
tcctcagactccgcatatgtgctgatccgagatgtagacgctgtgaaaaccgcagtgttt
caaggcacgcagcttttccactggagttctacaggaagcagggcagaagtggaattccat
ggggagtaccagcacataaagggaacatttagagcagagtattcttatattaagcctgag
gaggctaaacttatgtag

DBGET integrated database retrieval system