KEGG   Ictalurus punctatus (channel catfish): 108265726Help
Entry
108265726         CDS       T04658                                 

Definition
(RefSeq) mitogen-activated protein kinase 14A
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04010  MAPK signaling pathway
ipu04068  FoxO signaling pathway
ipu04218  Cellular senescence
ipu04261  Adrenergic signaling in cardiomyocytes
ipu04370  VEGF signaling pathway
ipu04620  Toll-like receptor signaling pathway
ipu04621  NOD-like receptor signaling pathway
ipu04622  RIG-I-like receptor signaling pathway
ipu04625  C-type lectin receptor signaling pathway
ipu04912  GnRH signaling pathway
ipu04914  Progesterone-mediated oocyte maturation
ipu04933  AGE-RAGE signaling pathway in diabetic complications
ipu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108265726
   04370 VEGF signaling pathway
    108265726
   04068 FoxO signaling pathway
    108265726
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    108265726
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    108265726
   04621 NOD-like receptor signaling pathway
    108265726
   04622 RIG-I-like receptor signaling pathway
    108265726
   04625 C-type lectin receptor signaling pathway
    108265726
  09152 Endocrine system
   04912 GnRH signaling pathway
    108265726
   04914 Progesterone-mediated oocyte maturation
    108265726
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108265726
  09158 Development and regeneration
   04361 Axon regeneration
    108265726
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108265726
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108265726
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ipu01001]
    108265726
Enzymes [BR:ipu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     108265726
Protein kinases [BR:ipu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   108265726
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 108265726
NCBI-ProteinID: XP_017323850
UniProt: A0A2D0R251
Position
5
AA seq 361 aa AA seqDB search
MSQKERATFYRQEVNKTVWEVPVRYQNLSPVGSGAYGSVCSAVDEKTGLKIAVKKLSRPF
QSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPSTSLEEFNDVYLVTHLMGADLNNIVKC
QKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEM
TGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLIMLLV
GTPGPELLTKMSSESARNYIHSLPQMPKRNFADVFIGANPQAVDLLEKMLVLDTDKRITA
ADALAHPYFAQYHDPDDEPEAEPYDQSFESRELEIEEWKRLTYEEVISFEPPAFDVDEME
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagaaagaaagagccacgttttaccgacaggaggtgaataagacggtttgggag
gtcccggtgcgctatcagaacctctctccagtcggctctggtgcatacggatctgtctgc
tcagcggttgatgagaagacaggtttgaagattgctgtgaaaaaactctcaaggccattc
cagtccattatccatgccaaaagaacctacagagaattgcggcttctcaagcacatgaaa
catgagaacgtaataggcctgctggatgttttcacaccttccaccagtctggaggagttc
aacgacgtgtacctggtgactcacctgatgggtgcagacctaaataatatagtgaaatgt
cagaagctgactgatgaccatgtgcagttccttatctaccagatccttcgagggcttaag
tacatccattcagcagacatcattcacagagacctgaagcccagtaatttggctgtgaat
gaagattgtgagcttaagatccttgattttggcctggcacggcatacggatgatgaaatg
acaggatatgtggccaccaggtggtaccgtgctcctgaaatcatgcttaactggatgcac
tacaacatgacagtggatatttggtctgttggctgcattatggctgagctgctgacaggg
agaacgctgttccctggcaccgaccacattgaccagctgaaacttatcatgctgctcgtt
ggaactccaggacctgagctgttgacgaaaatgtcatcagaatctgccaggaattacatt
cattctctgccacaaatgcctaaaaggaattttgctgatgtatttattggggccaatcca
caggctgtggacctcctcgagaagatgctggttttggatacggacaagaggataactgca
gctgatgctctggctcatccatactttgcccagtatcatgacccagatgatgaaccagaa
gcagagccttatgaccagagctttgagagtcgggaactagagattgaggagtggaaacgt
ttgacatatgaggaagtcatcagtttcgagccacctgcctttgatgtggatgaaatggaa
tcgtga

DBGET integrated database retrieval system