KEGG   Ictalurus punctatus (channel catfish): 108266357Help
Entry
108266357         CDS       T04658                                 

Gene name
otc
Definition
(RefSeq) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00220  Arginine biosynthesis
ipu01100  Metabolic pathways
ipu01230  Biosynthesis of amino acids
Module
ipu_M00029  Urea cycle
ipu_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    108266357 (otc)
Enzymes [BR:ipu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     108266357 (otc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-GeneID: 108266357
NCBI-ProteinID: XP_017325011
UniProt: A0A2D0R4N5
Position
6
AA seq 377 aa AA seqDB search
MKAQAGFEKSLGFILVCAVTRLLISMLALRNTVLHSLKAVKSDQARSFRLGRTSLGCVNL
KGRSFLTLKDFNPDEIKHILWVSADLKHRIKHEGQYLPLLQGKSIAMIFEKRSTRTRMST
ETGFALLGGHPCFLTPQDIHLGVNESTKDTARVLSSFTDIVLARVYSHSTLEQLDKEASI
PIINGLSDLYHPIQILADLLTLQEHYGSLKGLTMSWIGDGNNVLHSFMMSSAKLGINLRI
ATPKGYAPDANVTQEALRLSKEFGTELHLFSEPLEAAQGSNVLVTDTWISMGQEDEKMKR
LKDFHGYKITMKTGSVAAQDWTFLHCLPRKSEEVDDEVFYSPRSLVFPEAENRKWTIMGL
IACILTDYSPQIPKLKL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgcaggcggggtttgagaagagtttgggttttattttagtctgtgctgtaaca
cgacttctgatcagcatgcttgccctcaggaacaccgttctgcacagccttaaagctgtc
aagtctgaccaggcacggagtttcaggctggggaggacatctttaggatgtgtgaacctg
aagggacgcagtttcctcacgctgaaagacttcaaccccgatgagatcaagcacatcctg
tgggtgtctgctgacctaaagcatcggatcaagcatgaaggacagtatcttcctctcctt
caaggcaaatctattgccatgatattcgagaagagaagcactaggacccgcatgtccact
gaaacagggttcgctctattgggaggacatccatgtttccttacccctcaggatattcac
ctgggtgtaaatgagagcacaaaggacacagccagagtgctctcgagcttcactgatatt
gtgttagcccgggtgtacagtcactccactttggagcagctggataaggaagcttctata
ccaattatcaacggcctctctgatctttaccatcctatacagatactagctgatctgctc
actctgcaggagcattacggttctttgaagggcctgaccatgtcttggataggtgatggt
aacaatgtcctccactccttcatgatgtcatcggccaaattgggaataaatctgagaata
gctacgccaaagggttatgcaccagatgctaatgtcactcaggaggcgctgcgtctctct
aaagagtttgggacagagctgcacttgttttcagagccactggaggcagctcagggcagc
aatgtgctggtgacagacacgtggattagcatgggccaggaagatgaaaagatgaagagg
ctgaaggacttccatggctacaagatcaccatgaagacaggaagtgtagcagcgcaagac
tggactttcttgcactgtctcccacgaaagtcagaagaagtggacgacgaggttttctac
tcgccacgctcactggtgtttcctgaggctgaaaaccgcaaatggaccattatggggttg
atcgcgtgtatcctgaccgactacagtcctcagatccccaaactgaaactgtag

DBGET integrated database retrieval system