KEGG   Ictalurus punctatus (channel catfish): 108267074Help
Entry
108267074         CDS       T04658                                 

Gene name
rock1
Definition
(RefSeq) Rho associated coiled-coil containing protein kinase 1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04270  Vascular smooth muscle contraction
ipu04350  TGF-beta signaling pathway
ipu04510  Focal adhesion
ipu04530  Tight junction
ipu04810  Regulation of actin cytoskeleton
ipu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    108267074 (rock1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108267074 (rock1)
   04530 Tight junction
    108267074 (rock1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108267074 (rock1)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108267074 (rock1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108267074 (rock1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ipu01001]
    108267074 (rock1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ipu03036]
    108267074 (rock1)
Enzymes [BR:ipu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108267074 (rock1)
Protein kinases [BR:ipu01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   108267074 (rock1)
Chromosome and associated proteins [BR:ipu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    108267074 (rock1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH HR1 C1_1 Pkinase_C DUF724 Cortex-I_coil APH Filament
Motif
Other DBs
NCBI-GeneID: 108267074
NCBI-ProteinID: XP_017326502
UniProt: A0A2D0R7D9
Position
7
AA seq 1379 aa AA seqDB search
MSAGESLTARFEKIDAMLKDPKSEINTDCLLDGLDALVYDLDFPALRKNKSIDNFLSRYK
DTIGKIRDLRMKAVDYEVVKVIGRGAFGEVQLVRHKASSKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSSWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDGIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKDGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNALTFP
EDSDISKDAKSLICHFLTDREVRLGRNGVDEIKRHSFFKNDQWTWENIRETAAPVVPELS
SDTDTSNFDDIEEDRGEEETFPIPKAFVGNQLPFVGFTYYSGHQFSRGSSTKTSNKCNSA
TKEDKSQLENLLKKIHQLEEQLHGEMQLKDELEQKCRASNTKLEKIMKELDEECNVRKSA
EASVSLLEKDKLMLQHRTTEYQRKADQEGEKRRNLENEVSTLKEQLENMRKLSQNTQASS
EKIVQLQHQLEEANDLLRAESDTAARLRKSQTEMAKAMSQLESQNGELQEKSRAADDARR
QLERELLQLQNTLDTERRTCSQGSEEIRQLQARIAGLQEDNKNVKQSMSKVETERKQLQD
RNNILEKEKNSMEIDLNYKLKILQQRLDQELTEHRVTRAQLTDKYESIEEAKSAAMHAVE
QKVSEESVLRLRAESRVVEVEKQCSMLEFDLKQSVQKMEQLMKQKDRLEDEVKSLRVQLE
NECGKRAMAQSELKSWSGEAERLRGTEKQLKQEINAVLESKRSLEFQLAQLSKQYRGNEG
QMRELQDQLEAEQYFSTLYKTQVKELKEELEERNRLVQEVQRKVQEMHSERESLMAQLDL
TVTKAESEMLARALQEEQYFELSQESKKSLARHKQELIDRDSTITRLEESNKTLTKDVEN
LSREKGELDEKLQSQEEVFEAQREEISNAIKANYEKILNQERTLKTQAVNKLAEIMNRKD
MKLDQKKRGSTTDLRKKEKENRKLQLELNQEKEKFNHMAIKYQKELSEMQAQLVEESTYR
NELQMQLDSKESDIEQLREKLNDLQLRMENTSVTSLQTDEVDSNTAESRLEGWLSIPNRA
NIKRYGWRKQYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAESDE
IPRIFQILYANEGECRKDLDLEAIPQGEKSNYLAHKGHEFIPTLYHFPSNCEACAKPLWH
VFKPPPALECRRCHVKCHKDHLDRKEDVIAPCKVNYDVTSARDMLLLALTQDEQKKWIGH
LGKKIPKTPPSTFSRASPRAMSTRSVANQSFRKNPKSISGKSSRAQSNLHAAETSSSSC
NT seq 4140 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctggagagagtttaacggctcgttttgagaaaatcgatgccatgttgaaggat
cccaagtcagagatcaacaccgactgcctactggacggtttggatgctctggtctacgac
cttgattttcctgccctgaggaagaataagagcatcgacaacttcttaagcagatataag
gacaccatcggtaagatccgggatctgcggatgaaggctgttgactacgaggtggtgaag
gtgattgggagaggagcgtttggagaagtgcagctcgtgagacacaaggccagcagtaag
gtgtacgctatgaagcttctcagtaagtttgagatgataaagcgctcggactcggcgttc
ttctgggaggagagagacatcatggccttcgctaatagcagctgggtcgtacagctgttc
tacgccttccaggacgaccgttatctctacatggtgatggagtacatgcctggaggagac
ctggtcaatttgatgagcaattatgacgtgcctgagaagtgggctcgcttttacaccgcc
gaggtggtgctggcgctcgacggcatccactccatgggcttcatccacagggatgtgaaa
cctgacaacatgctgctggacaaatcgggccatttaaagctggcagatttcggcacttgc
atgaaaatgaacaaggatggtatggtacgatgtgacacggcagtgggaactccagattac
atttctccagaggtacttaagtctcagggcggagatggctactacggccgagagtgtgac
tggtggtctgtcggagttttcctctacgagatgcttgtcggggacactccgttttacgcc
gactctctggtgggaacctacagcaagatcatgaaccataaaaacgctctgacgttccct
gaagacagtgacatctctaaagacgccaagagcctcatctgccacttcctcaccgacagg
gaagtacggttagggcgtaacggagtggacgaaatcaagcggcattctttcttcaagaat
gaccagtggacctgggagaacatccgcgagacggcagccccggtcgtgccggagttaagc
agtgacaccgatacgagtaattttgacgatatagaggaggaccggggagaagaggagacc
ttccccatccccaaagcctttgtggggaatcagctcccgtttgtgggcttcacctattac
agcggtcaccagttttctcgaggatcgagcacaaaaacaagcaacaagtgtaacagcgct
actaaagaggacaagagccagttggagaatctgctgaagaaaatccaccagctggaggag
cagcttcatggagagatgcaactaaaggacgagctagagcagaaatgcagggcctccaac
accaaactagagaagatcatgaaagagctggatgaagagtgtaatgtgaggaaaagtgcg
gaggctagtgtgtccctgctggagaaggacaagctgatgctgcagcacagaaccactgag
taccagagaaaagcagatcaggaaggagagaagaggcgcaacctggagaacgaggtttcc
actctgaaagagcagctggagaacatgaggaagctcagccagaacacacaggcttccagt
gagaagatcgtccaactgcagcaccagctcgaagaggccaacgacctgctgagggcggag
tctgacacggctgcacgactgaggaagagtcagacagagatggcgaaggccatgagtcag
ctggagtcacagaacggagagctgcaggagaagagccgagccgccgacgacgccaggaga
cagctagagagagaactgctgcagctgcagaacacgctggacactgagagacggacctgc
agccagggatctgaggagatacgtcaactacaggctcgcattgcggggcttcaggaggac
aacaagaacgtgaagcagagcatgtccaaggtggagacagaaagaaagcagttacaggat
agaaacaacattttggagaaggagaagaacagtatggaaattgatctaaattataagctg
aagatcctgcagcagcgtttggatcaggagctaacggagcacagggtcacacgagctcag
ctcaccgataaatacgagtccatcgaggaggccaaatctgctgccatgcatgcggtggag
cagaaggtgtccgaggagagtgtgctgcgcctgcgtgctgagagtcgggtggtggaggtg
gagaagcagtgctccatgctggagttcgacctcaagcagtccgtccaaaagatggagcag
ctgatgaagcagaaggacagactggaggacgaggtgaagtctctgcgtgttcagctggag
aacgagtgcgggaagcgggcgatggctcagagcgagctgaagagctggagcggtgaagct
gaaaggctgagagggacggagaagcagctgaagcaggagatcaacgcggtgctggagtcc
aaacgctcactcgagttccagctcgcgcagctcagcaagcagtacagagggaacgagggt
cagatgagggagctgcaggatcagctggaggccgagcagtatttctctacgctgtataag
actcaggtgaaggagctgaaggaagaactggaggagaggaaccgtctggtgcaggaggtg
cagaggaaggtgcaggagatgcacagtgaaagggaatctctgatggctcagttggacctg
acagtgacgaaggccgagtcggagatgctggcgagagcattgcaggaggagcagtacttc
gaactgagccaggagagcaagaagagtttagcacgtcacaagcaggagctgatcgacagg
gactcgactataacacggcttgaggaatccaacaaaactctgaccaaagacgtggagaac
ctcagcagggagaaaggagagctagacgagaagctccaatctcaggaagaagtgtttgaa
gcccagagagaagaaatttcaaatgccatcaaggccaactacgagaagatcctcaaccag
gaacgaacgcttaagacacaggcggtgaacaaactggccgagatcatgaaccgtaaggac
atgaagctggaccagaagaagcgcggcagcaccacggacctgcgcaagaaggagaaggag
aaccgcaaactgcagctggaactcaaccaggagaaggagaagttcaaccacatggccatc
aaataccagaaggagctcagcgagatgcaggcgcaactggtggaggagagcacgtaccgt
aacgagctgcagatgcagttggacagtaaagaaagcgacatcgagcagctccgagagaaa
ctgaacgacctgcagctgcgcatggagaacaccagtgtgaccagtctgcagacggacgag
gtcgacagcaacactgcagaatcgagattggaaggctggctctccatcccgaacagagcc
aatatcaaacgatatggttggaggaagcagtatgttgtggttagcagtaagaagatcctg
ttctataatgatgagcaggataaagagcagtccaatccttccatggtgcttgacattgac
aaactcttccatgtgcgtccagtaacccaaggcgatgtttatcgtgctgaatcagatgaa
attcccagaatattccagattctctatgctaacgagggtgaatgccggaaggatctggac
ctggaggctattcctcaaggtgagaaatcgaactacctggctcacaaagggcacgagttt
atccctacactctaccactttccctcaaactgtgaggcctgtgccaaaccactgtggcat
gtcttcaaaccaccgcctgcactcgaatgccgacgatgccacgtcaaatgccacaaagac
cacctagacaggaaggaggacgtcatcgcgccatgcaaagtgaactatgacgtgacgtca
gcacgtgacatgctcctgctagctctcacccaggacgagcagaagaaatggattggccat
cttggcaagaagattcctaaaacacctccatctactttctctcgagcatcacctcgcgcc
atgagcactcgctcggtagctaatcagtcgttccgcaaaaaccctaaaagcatctctgga
aagtccagcagggctcaatccaacctccacgcagcagaaacatcatccagctcctgctga

DBGET integrated database retrieval system