KEGG   Ictalurus punctatus (channel catfish): 108267970Help
Entry
108267970         CDS       T04658                                 

Gene name
gba2
Definition
(RefSeq) glucosylceramidase beta 2
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00511  Other glycan degradation
ipu00600  Sphingolipid metabolism
ipu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    108267970 (gba2)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    108267970 (gba2)
Enzymes [BR:ipu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     108267970 (gba2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N
Motif
Other DBs
NCBI-GeneID: 108267970
NCBI-ProteinID: XP_017328072
UniProt: A0A2D0RC03
Position
7
AA seq 871 aa AA seqDB search
MDLNDSRSLSELMARYEGTETGFGVPKDGWRICLAHEFKEKRKPFQAKDVSLSHILQHIG
LGFRYLKWWYQRTKIEKKAPFIDIFNALPLRPIYGAPLGGIGGGSITRGWKGEFCRWQLN
PGMYHYKTVIADQFTVCLRRDGQTIYQQVLSTERPHTLQDWNWGYCGAFAFYHALYPRAW
TVYQLPGQNVTLTCRQVSPVIPHNYKDSSFPVAVFVWDIENKNDYALDVTIMFTMVNGSG
HKEEKCGGHWNEPFHLEKEGESVSGVLLHHCSAVNPYTLCMASREQSNRKITHQTAFSPN
DTGKAVWSDLISDGQLDSPTGSSPPIQRGETVAAALAVGCSVPAHGHNSLEFCLAWDMPK
ITFGSREREHIRRYARYYGTKGNAGPALSHYALTHYKDWEKGIAEWQRPILEDGSLPSWY
KSALFNELYFVVDGGTVWLELPEDWDVSGGLRPEEGGLPAQPPVLKEYGRFAYLEGQEYR
MYNTYDVHFYASFALIMLWPKLALSLQYDIAGSVVQYDPTERVNLMNGHCSPVKTRNVVP
HDIGDPDDEPWQRVNAYQIHDTADWKDLNLKFVLQVYRDYHLTQDLQYLMDMWPICQVVM
ETEMKFDTDGDGLIENSGYADQTYDGWTVTGPSAYCGGLWLASLCVTCKMAQLLKNDSVY
ERYRDILKRGSAAFDKLLWNGKYYNYDSSGRNMSNSVMSDQCAGQWFLGASGLGDEEFEV
FPKEKICSALKSIFDLNVMSFAGGQMGAVNGMRPEGVPDRSSVQSDEVWVGVVYGLAATM
IQEGLLEEGLHTAEGCYRTVWEQTGMAFQTPEAYCEKGIYRSLAYMRPLSIWAIQLALDN
RTNVSKTTQPDSEAARLQTALQDEPVKENCH
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atggatttaaatgacagcaggtcgttatccgagctcatggccaggtatgagggcacggaa
accggattcggtgtgcctaaggatgggtggaggatctgcctggcgcacgagttcaaggag
aaaagaaaaccttttcaggctaaagacgtgtccctgtcccacatcctgcagcacatcggc
ctgggcttcaggtatttaaaatggtggtaccagagaacaaagattgagaagaaagcaccc
ttcatagacatattcaatgctttgcctctaaggccgatttatggtgcccccctgggtggc
attgggggaggaagcattacacgtggatggaagggagagttctgtaggtggcagcttaac
ccaggaatgtaccactacaaaacagtcattgctgaccagtttacagtttgcctacgtagg
gatggtcagacaatctatcagcaagtgttgtccaccgaacgtcctcacacactgcaggac
tggaactggggttactgtggtgcgttcgcgttctaccatgcactctatccccgagcctgg
accgtctaccagctgcccggccagaacgtcacccttacctgcaggcaggtgtcacctgtc
atcccacacaactacaaggactcaagttttccggttgccgtgtttgtgtgggatatagag
aacaagaatgactacgcactggatgtcacaatcatgtttaccatggtcaatggatcaggc
cacaaggaggaaaaatgtggcggtcattggaatgaaccattccacttggaaaaagagggc
gagtcagtgtcaggggttttgcttcaccactgctcagcggtgaacccgtacacactgtgt
atggcatctcgagaacagtccaacagaaagattacccaccagactgctttcagtcctaac
gacactggaaaagctgtttggagtgatctgataagtgatggccagttagactcacccact
ggctccagccctccaattcagagaggagagacagtggcagcggcactggcggtgggctgc
tctgtgcctgctcatggacacaacagcctggagttctgcctggcctgggacatgccaaaa
attacttttggctcgagggaaagagagcacatcagacgttatgcacgttactatggtacc
aaaggaaacgcaggcccagctctttcacactacgcacttacacattacaaagactgggag
aagggcattgcggagtggcagagacctattctggaagatggttctctcccttcctggtat
aaatcagccttgtttaatgagttatactttgttgtggatgggggcacggtgtggttggag
cttcccgaagactgggatgttagtggagggcttcgcccagaagaaggtggtcttcctgca
cagccccctgtcctcaaggaatatggccgctttgcctatttagagggtcaggagtacagg
atgtacaacacatacgatgtgcacttctatgcctcctttgcacttatcatgctctggccc
aaactggctctgagtctacagtatgatattgctggtagtgtggtacagtatgaccccaca
gaaagggtgaacctcatgaatgggcattgctcacctgttaagaccaggaatgtagtacct
catgacattggagacccagatgacgagccttggcaacgtgtcaatgcctatcaaattcat
gacacggcagactggaaagacctgaacctgaagtttgttctgcaggtgtaccgtgactac
cacctaactcaggacctgcagtacctgatggacatgtggcccatctgccaggtggttatg
gagactgaaatgaagtttgatacagatggggatggcctaatagagaactccggctatgct
gaccaaacttatgatggctggactgtaacaggacccagtgcatactgtgggggtctgtgg
ctggcttcgctgtgtgtgacgtgtaagatggcacaacttcttaaaaatgactctgtgtat
gagcgctacagagacatcttgaagcgaggcagtgccgcctttgataaactactgtggaat
ggcaaatactataactatgacagcagtgggcgaaatatgtccaacagtgtgatgtctgac
caatgtgcaggccagtggttcctcggggcatctggattaggagatgaggagtttgaggtt
ttccctaaggagaagatctgcagtgcgctgaaaagcatatttgatctgaacgtgatgagc
tttgcaggaggacagatgggggctgtgaatggcatgagaccagagggtgtgcctgatcgc
tccagcgtccagtcagatgaggtctgggttggtgtagtctatggattggcagctactatg
attcaggagggtctgttagaggaaggacttcacactgctgaaggttgctatcggacagtg
tgggagcagacaggaatggcctttcagactcctgaggcatactgtgaaaaagggatctat
cgctccttggcttacatgagacctctcagcatctgggccatacagctggccctggacaat
cggacaaatgtgagcaagactacgcagccagacagcgaggcagctcgtttacagacggcc
ttacaggatgaaccggttaaagagaattgccattaa

DBGET integrated database retrieval system