KEGG   Ictalurus punctatus (channel catfish): 108268908Help
Entry
108268908         CDS       T04658                                 

Definition
(RefSeq) transforming growth factor beta-2-like
  KO
K13376  transforming growth factor beta-2
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04010  MAPK signaling pathway
ipu04060  Cytokine-cytokine receptor interaction
ipu04068  FoxO signaling pathway
ipu04110  Cell cycle
ipu04218  Cellular senescence
ipu04350  TGF-beta signaling pathway
ipu04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108268908
   04350 TGF-beta signaling pathway
    108268908
   04068 FoxO signaling pathway
    108268908
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108268908
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108268908
   04218 Cellular senescence
    108268908
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108268908
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ipu04052]
    108268908
   00536 Glycosaminoglycan binding proteins [BR:ipu00536]
    108268908
Cytokines and growth factors [BR:ipu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   108268908
Glycosaminoglycan binding proteins [BR:ipu00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   108268908
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 108268908
NCBI-ProteinID: XP_017329739
UniProt: A0A2D0RGT1
Position
8
AA seq 415 aa AA seqDB search
MWFINIALLILKLSVSAEGFSTCQSYDLDDHKSKRIEAVRGQILSKLRIRSPPDPAAAPQ
PESVPFEVMLLYNSTKDLLKERARHAESACERESSEEDYYAKEVQRVDMLPQRADSNVIN
TVPQSPHFRVVKFDVTSVDRNSSTLVKAEFRIYRVQNTHAQATEQRVEIYQILKSDDVSG
SHHRYIDSRTVQPGAKAAWLSVDVTETVKEWMAYKEKNLGLMLSVHCPCCTFIPSTNNIV
PNKSEELEARFAGVDDDLIRPNRRPGLTKGQIEFSTKTPHLILTLRPTDRLENPNKKNRK
KRAAADATTCSRNADQGCCLRSLYIDFRRDLNWKWIHEPKGYKANFCAGNCPYLWSADNH
YNMILPLYNKMNPEASASPCCVPQDLEPLTIVYFLGRTPRVEQLSNMVVKSCKCR
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgtggttcatcaatatcgcgctgcttatcctaaagttatcggtctcggctgagggcttt
tcgacgtgtcagtcttatgacttggacgatcataagtcgaaaaggatagaggcggtgcgc
gggcagatcctgagcaagctgcgcatccgatcaccacccgaccccgcagccgccccgcag
ccggaatccgtgcccttcgaggtcatgctgctctataacagcaccaaggacctgctgaag
gagcgcgcgcgccacgccgagtccgcctgcgagcgcgagagcagcgaggaagattactac
gctaaagaggtgcagagagtggacatgctgcctcagcgcgccgactccaacgtgataaac
acagtgcctcagagtccacacttcagagtggtgaagtttgatgtcaccagtgtagacagg
aattctagcacacttgtcaaggcagagtttcgcatatacagggtgcagaacacacatgca
caagccacggagcagcgagtggaaatataccagattctgaaatctgacgatgtttcaggt
tcccatcataggtacatagattccagaactgttcagccaggagccaaggcggcgtggttg
tctgttgacgtcacagagactgtgaaagagtggatggcttataaagagaagaacttgggc
ctgatgctcagtgttcattgtccatgctgcacttttattccatccacaaataatattgtg
cccaacaagagtgaggagttggaagctcgatttgcaggtgttgatgatgacctgattcgc
cctaacaggaggccaggtctgactaaaggccagatagagttcagtactaaaacaccacac
ctcatattgaccctgcggcccacagatcgtttggagaaccccaacaaaaagaaccgcaag
aagagggcagctgctgatgctacaacatgctccaggaatgcagatcaaggctgttgctta
aggtctctgtacatcgacttccgtcgggacctaaactggaaatggatccatgaaccgaaa
ggatacaaagcaaatttctgtgctggcaactgcccctacttgtggagtgcagacaatcac
tataatatgattttgccgctttataacaaaatgaatcctgaggcgtctgcgtctccctgc
tgtgtgcctcaggacctggagcctctcactattgtttacttcctcggtcgaactccacgg
gtggagcagctgtcaaacatggtggtcaaatcctgcaaatgccgctga

DBGET integrated database retrieval system