KEGG   Ictalurus punctatus (channel catfish): 108269046Help
Entry
108269046         CDS       T04658                                 

Definition
(RefSeq) cAMP-responsive element modulator-like
  KO
K09052  cAMP response element modulator
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108269046
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ipu03000]
    108269046
Transcription factors [BR:ipu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    108269046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Rh5 Phage_Gp23
Motif
Other DBs
NCBI-GeneID: 108269046
NCBI-ProteinID: XP_017330042
UniProt: A0A2D0RIS4
Position
1
AA seq 262 aa AA seqDB search
MEVRQHSQTRPLKSQNTFMDIKSSPLQVNMESQSTMTQDSALHQQALGNSTNGKYGEDIF
DPSSSYRNNLNELGSIAPMAMMVAETLTNEQAAPPSVHAPTYYNTNRGQIYDIKSEAADW
QIDSSDPGYQSFTISTSDAPQPCPAFVQCLQYYAPANTMVAEAGTGDVSAYQICSPTSSL
PQGVAMASSTSPLHSSQQLGEEASRKRELRLMKNREAARECRRKKKEYVKCLENRVAVLE
NQNKTLIEELKALKDLYCRKTE
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggaagttagacaacactcgcagactcgtcctctgaagagtcaaaataccttcatggat
ataaaaagttctcctctacaagttaatatggaaagtcagtctactatgactcaagattct
gcacttcatcagcaagcactggggaactccacaaatgggaaatatggagaagatatcttt
gatccaagtagctcctacaggaataatctgaatgagcttggttcgattgcacctatggcc
atgatggttgcagaaacgttgacaaatgaacaagctgctccccctagtgtacacgcaccc
acctactacaacaccaacagaggccagatttatgacatcaagtctgaggcagcagattgg
cagattgacagcagcgatccgggctatcagagtttcaccatatccacttcagatgcccca
cagccatgccctgcctttgtccagtgtcttcaatattatgcccctgccaacacaatggta
gctgaagctggtactggagacgtgtcagcatatcagatctgttctcccacctccagcctg
ccacagggtgtagcgatggcgagctcaaccagccctctgcacagctctcagcaacttggt
gaggaggcctcacgcaagagggagctccgcctgatgaagaacagggaagctgcacgggaa
tgtcgccggaagaagaaagagtatgtcaaatgtctcgagaatcgtgttgccgtgcttgaa
aatcaaaacaagacactcatcgaagaactcaaggcattaaaagacttgtactgtcgcaag
actgaataa

DBGET integrated database retrieval system