KEGG   Ictalurus punctatus (channel catfish): 108269179
Entry
108269179         CDS       T04658                                 

Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1-like
  KO
K04462  ecotropic virus integration site 1 protein
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108269179
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ipu03000]
    108269179
Transcription factors [BR:ipu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    108269179
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-C2H2_jaz zf-C2H2_8 zinc_ribbon_15 zf-BED zf-H2C2_5 PyrI_C zf_UBZ
Other DBs
NCBI-GeneID: 108269179
NCBI-ProteinID: XP_017330354
UniProt: A0A2D0RIJ6
Position
1
AA seq 868 aa
MKAEEFSFEAMAPDIHEERQFRCEDCEQLFPSGSELLEHQNHSCSNRPSSGFTLPEQAIP
SATDECKECERVFPDGQSLEAHSLSHSDEREYKCDQCPKAFNWKSNLIRHQMSHDSGKHY
ECENCSKQVFTDPSNLQRHIRSQHVGARAHACPDCGKTFATSSGLKQHKHIHSSVKPFMC
EVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHFAAAAG
GLFGPGMALPGTPGMDKSALGMGPGSAGLADYFGPNRHHGGLTFPAAPAAFPFSFPGLFP
SGLYHRPPLIPATTPIKSPPALEFQKSPPLSSPLPGMQESQDLLMSLRKHSINGEGTENG
PEHLIEGSATKARQGIKTSDNSESSDLDDVSTPSGSELESTSGSELDSDAESDRDRERNR
ENGKGPKRRSSSPTMGQSPAHGSSSNGSVGNINGTDVPPQRLFSPVSDERTAVSGAVNDS
IKAIASIAEKYFGSTGLAGLHNKKGDPLGYPAMFPLPFFPAFSPPVYPFHEREHLRPRDH
KAEPESPSQESKKPQGSTAESPFDLTTKRKEECLAQTFATSKLEVPRILSANQDQPLDLS
LGGRGRSTRLRSGESQKNHMIGEDRNETEPPKADSTIQHARPTPFFMDPIYRVEKRKATD
PFEALKEKYMRPTPGFLFHPQLRMPDQRTWMSAIENMAEKLEAFGPLKSDAGDIMRSVPS
VFDFRAPATTLPETLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSF
SISSKGTSTTKRNRSNATCVTAALANRPTWTGTSKNTRTARRCPHHSQSWTAAVLSWMIK
RTRTSTRFAISSAAVARALAHLHTPMKV
NT seq 2607 nt   +upstreamnt  +downstreamnt
atgaaggctgaagagttttcatttgaggccatggctccagatatacacgaggagcgtcag
ttccgctgtgaggactgcgagcagcttttcccgtccggctcagagctgctggagcatcag
aaccactcgtgttccaaccggccctcgtccggcttcacgctgcccgagcaggccatcccg
agcgccaccgacgagtgtaaagaatgtgagagagtgtttccggatggtcagagtctggag
gcacactctctctcccactcagacgagagggagtacaagtgtgaccagtgcccgaaggcc
ttcaactggaagtccaacctgattcgccaccagatgtcacatgacagcggcaagcactac
gaatgtgaaaactgctccaagcaggtgtttacagacccaagcaacttgcagaggcacatc
cgctcgcagcacgtcggtgcacgggcgcacgcctgccccgactgcggcaaaaccttcgcc
acgtcgtccggcctcaagcagcacaaacacatccactcgtccgtcaagcccttcatgtgc
gaggtgtgccacaagtcctacacccagttctcaaacctgtgtaggcacaagcgcatgcat
gctgactgtcggactcagatcaagtgcaaagactgtggccagatgtttagcaccacctct
tccctcaacaaacaccgccgcttttgcgaaggcaaaaaccattttgctgctgccgcagga
gggctttttggccctggcatggctcttcctggcactcccggaatggacaagtctgctcta
ggaatggggccaggatccgctggtttggcagattattttggtccaaataggcaccatggt
ggactaacgtttccagcagctcctgcagcattccccttcagttttccaggactcttccca
tctggactgtaccaccgaccacccctcatccctgccacaactcccataaaaagcccacca
gccttggaattccagaagagtccaccattatcctcacctttgcctgggatgcaagagtcc
caggacctcctgatgagcctccgaaagcactcgatcaacggggaaggaacagaaaatggg
ccagagcatctgatagaaggctccgccactaaggcaagacagggcattaagacaagtgac
aattcagagagcagtgacttggatgacgttagcactccaagtggaagtgagctagagagt
acttccgggtcagaactggacagcgatgctgagagtgaccgggatcgagaaaggaatcgg
gaaaatgggaaaggaccaaagaggagatccagtagtcctaccatggggcaaagccccgcc
cacggcagctccagcaatggcagtgttggcaacataaacggaactgatgtgcctccacaa
cgacttttttctcccgtttcggatgagcgcaccgctgtttctggagctgtcaatgattcc
atcaaggccattgcgtccattgcagagaaatactttggctccacaggactggcaggtctg
cacaataaaaaaggggacccactgggataccctgccatgtttcccctccccttcttccct
gctttctctccaccagtctaccccttccatgagagggagcatcttcgacctcgagaccac
aaagcagagccagagagcccatcgcaagaaagcaagaagccacaaggcagcactgctgaa
tctcccttcgacctcaccacaaagcgcaaagaggagtgcctagcgcagacctttgccacc
tcgaagctggaggtaccccgtatactctctgccaatcaggaccaaccactggacctgagt
ttgggtgggcggggccggagcacacgccttagatcaggggagtcacagaagaaccacatg
attggtgaagacagaaatgagacagagcctccaaaagcagactccaccatccagcatgca
agacccaccccattctttatggaccccatttacagggttgagaagagaaaagcgacggat
ccgttcgaggcgctgaaagaaaagtatatgcgtcccacaccaggcttcctcttccaccca
cagctccgcatgcctgatcagaggacctggatgtcagcgatagaaaacatggcggagaag
ttggaagcgttcggcccgttgaagtccgacgccggcgacatcatgcgctcggttccctcc
gtgttcgatttccgagctccggccacgacgctgcccgaaacactgctgcgtaaggggaag
gaacgctacacatgcagatactgcggcaaaatattcccacgctcagctaacctcacacgc
catctccgaacacacacaggggagcaaccgtacaggtgtaagtattgcgatcgttcgttc
agtatctcgtcaaaaggaacatccacaacaaagagaaaccgttcaaatgccacctgtgtg
accgctgctttggccaacagaccaacctggaccggcacctcaaaaaacacgagaacggca
cggcgatgtcctcaccacagtcagagctggacagcagcagtgctatcctggatgataaag
aggactcgtacttcaacgagattcgcaatttcatcagcagcagtggccagagcgctggct
cacctccacactccgatgaaggtttaa

DBGET integrated database retrieval system