KEGG   Ictalurus punctatus (channel catfish): 108269260
Entry
108269260         CDS       T04658                                 

Gene name
apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04080  Neuroactive ligand-receptor interaction
ipu04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108269260 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108269260 (apln)
SSDB
Motif
Pfam: Apelin DIM
Other DBs
NCBI-GeneID: 108269260
NCBI-ProteinID: XP_017330509
UniProt: A0A2D0RJ01
Position
8
AA seq 77 aa
MNVKILTLVIVLLLSLLCSARAGPVTSTEHSKELEEVGSMRTPVRQNPARAGRNQRPSGW
RRRRPRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatgtgaagatcctgacgctggtgattgtgctgctgctttctctgctgtgttcagcc
cgtgctggtccagtgacctccaccgagcatagcaaggagctggaggaggtgggtagcatg
aggactcctgtgcgtcagaaccctgcccgagctggccggaaccaaagaccctccggctgg
aggaggaggcgccctcgaccccgtctgtcccacaaggggcccatgccattttag

DBGET integrated database retrieval system