KEGG   Ictalurus punctatus (channel catfish): 108269775Help
Entry
108269775         CDS       T04658                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform-like
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00071  Fatty acid degradation
ipu01212  Fatty acid metabolism
ipu03320  PPAR signaling pathway
ipu04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    108269775
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108269775
   03320 PPAR signaling pathway
    108269775
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ipu03029]
    108269775
Enzymes [BR:ipu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     108269775
Mitochondrial biogenesis [BR:ipu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    108269775
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 108269775
NCBI-ProteinID: XP_017331271
UniProt: A0A2D0RL88
Position
1
AA seq 784 aa AA seqDB search
MAEAHQAVAFQFTITAEGIDLQLSHEALRQVYLSGLRSWKKRVIRLKNNVITGVYPASPS
SWLFVVIAILATMYTRSDPSMGLIAKIQEHLPASGSLSLQCQTVVSAVVFSTLLWLSLIF
TMKLCLKQLLSYHRWMFEQHGNVSTTTKIWVMLVRIFSGRQPLLYSYQGSLPNLPVPAVK
DTVKRYLESVRPLMSDSEFERMATLARDFELTLGSRLQWYLKLKALWASNYVSDWWEEYI
YLRGRGPIMVNSNYYGMDFMFVTPTPIQAARAGNTLHALLLYRRKLNKEEIKPSRIPGTF
IPLCAAQCERLFNTTRTPGEETDTVVHWNDSEHVAVYHRGRYFRLWLYQAGRMLTPREIE
QQIQRILDDKSAPAPGEEKLAALTAGDRIPWAQARKEFFSSGLNKRSLDSVEKAAFFVTL
EDEEQGMMGDDPAASMDRYAKSLLHGKCYDRWFDKSFTVVVYKNGKNGLNAEHSWADAPI
VSHMWEYVLTMDSFQLGYNQEGHCKGDGNPSLPHPQRLSWVIPSQCQERIAHSLSVAQVL
ADDVDFHVFAFRDFGKGSIKKVRMSPDAFIQLALQLAYYRDRGMFCLTYEASMTRLFREG
RTETVRSCSSESCAFVKAFENGEAADTCQRLLRTAAEKHQMLYRLAMTGAGIDRHLFCLY
VVSKYLGVESPFLKEVLSEPWRLSTSQTPFQQVELFDLVNHPDYITCGGGFGPVADDGYG
VSYSIIGEKIISFHVSSKRSCPQTDCHKFGAQLRKAMLDLLQLMMDDKKEVAQREQNHTA
KKEL
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggcacatcaggcagtagcgttccagttcactataaccgccgagggcatagac
ctgcagctctctcacgaggccctgagacaggtttatctctccgggcttcgctcctggaaa
aagcgcgtcatacgcctcaagaataatgtgattacaggtgtgtatcctgcgagcccgtct
tcctggctgtttgtggttatagcgatcctggccacaatgtacacgcgctcggatccgtcc
atgggcctcatcgctaagatccaggagcacctgccggccagcggctctttgagtctgcag
tgccagacggtcgtctcggccgtggtgttcagcactctgctgtggctgtccctcatcttc
accatgaagctatgcctgaagcagctgctctcgtaccatcgctggatgttcgagcagcac
ggcaacgtgtccaccaccaccaagatctgggtgatgttggtgaggatcttctctggtcgc
cagccgctactgtatagttatcaaggttctctgcctaatctgccagtacctgctgtcaaa
gacaccgtcaaaaggtatttggagtccgtgcgtcctctgatgtccgactcggaatttgag
aggatggcaactctagcgagagattttgagctcactctagggagccgccttcagtggtac
ctcaagctcaaggcattgtgggcctccaactacgtaagtgactggtgggaggagtacatc
tacctgagaggccgaggccccattatggtgaacagcaactactatggcatggactttatg
tttgtgaccccgactccgatccaggcagccagagcaggaaacacactgcacgctctcctc
ctgtaccgcaggaagctaaacaaagaggaaatcaaacctagccgtatccctggcacattc
attcctctgtgtgcagctcagtgtgagaggcttttcaacacaacacgaaccccaggagag
gagacagacacagtggtgcactggaacgacagcgagcacgtggccgtgtaccacaggggg
cgatatttccgtctgtggctctatcaggcaggcaggatgctgacaccgcgcgagatcgaa
cagcagatccagcgtatcctggacgacaagtccgccccagcaccaggcgaggagaaactg
gcagcgttaactgcaggggacagaattccatgggctcaagccaggaaggagttcttcagc
tctggcctcaacaagagatctctggacagcgtcgagaaagccgcgttcttcgtcactctg
gaagacgaggagcaaggcatgatgggagacgacccggccgctagcatggaccgctacgcc
aagtctctccttcacggaaaatgttacgacaggtggtttgataagtcgtttactgtggtg
gtgtacaagaatgggaagaacggcctgaacgccgagcactcctgggctgacgctcccatc
gtctcgcacatgtgggagtatgtcctgaccatggacagtttccagttgggttataatcaa
gagggacattgtaaaggggatgggaatccgtctctgccacacccacagagattatcctgg
gttattccttcgcagtgtcaggagcgcattgcccattcgctctcggtagcgcaggtgctg
gccgacgacgtcgactttcacgttttcgccttccgagatttcggcaaaggcagcatcaaa
aaggtccgcatgagcccagacgccttcatccagttagcgctgcagctagcctactacagg
gaccgagggatgttctgcctgacgtacgaggcgtcgatgacgcgtctgttccgtgagggc
cggaccgaaaccgtgcgctcgtgctccagcgagagctgtgccttcgtcaaagcgttcgag
aacggagaggcggcggacacgtgccagcgtttgttgcgtacggcggctgagaaacatcag
atgctctaccggctggccatgacgggagccgggattgaccgacacctcttctgcctctac
gtcgtctcgaaatacctgggtgtcgagtcacccttcctcaaggaggtgttgtctgagccg
tggcgtctctccaccagtcagactccattccagcaggtggagctgtttgacctggtgaat
caccccgactacatcacatgcggtggaggatttgggcctgttgctgatgatggatacggc
gtgtcttacagcatcatcggagagaagatcatcagcttccacgtctccagcaagcgctcc
tgtcctcagactgactgccataagttcggggcgcagctcaggaaggcgatgctggatctt
ttgcagctcatgatggacgataagaaagaagtggcacaacgcgagcagaaccacactgcg
aagaaagaactgtag

DBGET integrated database retrieval system