KEGG   Ictalurus punctatus (channel catfish): 108269899Help
Entry
108269899         CDS       T04658                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ipu01002]
    108269899
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ipu04147]
    108269899
Enzymes [BR:ipu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     108269899
Peptidases [BR:ipu01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   108269899
Exosome [BR:ipu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   108269899
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Thioesterase Abhydrolase_2 Peptidase_S9 Peptidase_S15 Say1_Mug180 Chlorophyllase2 Abhydrolase_4 COesterase
Motif
Other DBs
NCBI-GeneID: 108269899
NCBI-ProteinID: XP_017331519
UniProt: A0A2D0RLY2
Position
9
AA seq 392 aa AA seqDB search
MSYSLFRICSVPGVSAMRRRNNSPLEEHESSLTLQNRGTDLTDDGDRSTETERAMRRKYR
RSRLMWRLTRIFLWVLGIYIAIPFIIKLFPFIQAKLVFLNFVRVPYFIDLKKPLDQGLNH
THNFYLQPEEGVHIGVWHTVPALLWKEAQGKDRSWYESKLQSSHPVMLYLHGNAGTRGGD
HRVQLYKVLSSLGYHVVTFDYRGWGDSEGSPSEKAMTQDALFLYQWLKQRIGSNPLYIWG
HSLGTGVATNLARRLCDRGTPPDAVILESPFTNIREEAKSHPFSMVYRYLPGFDWFFLDT
ITANDIRFASDENVNHMSCPVLILHAEDDPVVPFHLGKKLYNIAAQSKSLNGHKVQFIPF
PSAQGYRHKFIYRSSQLPHILSDFLSTTHPHL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtcatattctcttttccgcatctgctcagttcctggcgtttcagcgatgcgaaggcgg
aataactctcccctcgaagagcacgaaagctccctcacgctgcagaaccgggggacggat
ctgacagacgacggagacaggagcacagagacggagagagccatgaggcgaaaataccgg
aggagtcgtttgatgtggaggttgacgaggatcttcctctgggttttggggatctacatt
gctattccgttcatcatcaagctctttcctttcatccaggctaagctggtctttttaaac
tttgtgagggtgccatattttatcgatcttaagaagccgctcgatcaaggcctgaaccac
acccacaacttctaccttcagccagaggaaggtgttcatattggagtgtggcacacagta
ccagccctgctgtggaaggaggcacagggaaaagatagaagctggtatgaaagcaagctc
cagtcctctcatcctgtcatgctctatctgcatggcaacgcaggcaccaggggaggagac
cacagagtgcagctctataaggtccttagttcattaggctaccatgtagtcacattcgat
tatagaggttggggggattcagagggcagcccttctgagaaagcgatgacacaggatgct
ctcttcctctaccagtggctgaaacagaggatcggcagcaacccgctctacatctggggc
cactctctgggaaccggagtggccactaacttagccaggcgtctgtgtgacagagggaca
ccacctgacgctgttatcctggagtctccttttactaacatcagggaggaggccaagagc
caccctttctccatggtttacaggtatctgccaggctttgactggttctttttggacacc
atcactgccaacgacatccgatttgccagcgatgagaatgtgaatcatatgtcctgtcca
gtcctaattctccatgctgaggacgatcccgttgtccctttccacttaggaaaaaagctg
tacaatatagcggctcagtccaagagcctgaatggacacaaggtacagtttattccattt
cccagcgcgcagggctacaggcacaagttcatctaccgcagttcccagctgcctcacata
ctcagtgactttctcagcacgactcatccacacttataa

DBGET integrated database retrieval system