KEGG   Ictalurus punctatus (channel catfish): 108271855Help
Entry
108271855         CDS       T04658                                 

Gene name
dock7
Definition
(RefSeq) dedicator of cytokinesis 7
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ipu04131]
    108271855 (dock7)
Membrane trafficking [BR:ipu04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    108271855 (dock7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N TEA
Motif
Other DBs
NCBI-GeneID: 108271855
NCBI-ProteinID: XP_017335208
UniProt: A0A2D0RXI1
Position
11
AA seq 2129 aa AA seqDB search
MAERRAFAQKISRTVAAEVRKQIAGQYGGSPQLLKNLHMGGNAASNSVPLTEAVEPVDFE
EYLITHPPIIESGPLRDLIEFPQDDIEVIYTPRECRTLGQAVPEEGDNDAHVRDCIRSYT
EDWAIVNRKYHKLGTGFNPNTLDKQKERQRGLPKQVFESDELPDPSSYQDDQDDLKRRSM
SIDDTPRGSWACSIFDLKNSQPDALLPHLLDRVPNEEIDRHNEEQRKSNRHRELFALHPA
LDEEEPIERHCVPDVPKEHFGQRLLVKCLSLKFEIEIEPIFASLALYDVKEKKKISENFF
FDLNSEQTKAMLRPHIQTAAISTLARSAIFSITYPSQDVFLVIKLEKVLQQGDIGECAEP
YMVFKESDAAKNKEKLEKLRAQSEQFCQRLGRYRMPFAWTAIHLMNIVNSAGSLERDTEL
EMGLPERKGSWSERRNSSIVGRRSLERTTSGDEYCNLTSFRPATLTVTNFFKQEGDRLSD
EDLYKFLADMRRPSSVLRRLRPITAQLKIDISPAPENPHYCLTPELLQVKPYPDTRVRPT
REILEFPAKDIYVPNTTYRNLLYVNPQSLNFANRQGSARNITVKVQFMNGEDPSNAMPVI
FGKSSCGEFSKEAYTAVVYHNRSPDFHDEVKIKLPASLNDHHHILFTFYHVSCQQKQNTP
LETPVGYTWIPMLQNGRLRTGHFCLPVSLEKPPQSYSVLSPDVPLPGMKWVDNHRGVFNV
EVVSVSTIHTQDQYLDKFFALVHALDEHMFPVRIGDMRIMENSLEAELKGSIAALSSSQL
EPVVRFLHLLLDKLVLLVVRPPVIAGQIVNLGQAAFEAMASIVNRLHKYLDTSQDMHGRN
SLLSSYIHYVFRLPNMDPNSPSPGPGGLGGSVHYATMARSAIRPASLNLNRSRSLSNSNP
DISGTPTSPDDEVRSIIGTKAMDRSGNRMSSHTESASFLQTLTGRLPTKKLFHEELALQW
VVSSGSVREGALQQAWFFFELMVKSIIHHLYFADRLESPRKNRFPERFMDDITALVSTIA
GDIVSRFQKDLELVERLNTSLAFFLNDLLSVMDRGFVFSLIKAYWKQVSTKLYALQNPTL
ESLRLDFLRIVCSHEHYVTLNLPCSLLTPPASPSPSVSSATSQSSGFSTHVQDQKIANMF
ELSVPFREQHYLAGLVLTELAVILDPEADGSVHWMFGLHKKVISVVHNLLSSHDSDPRYA
DPEVKARVAMLYLPLIGIIMETLSQLHDFTESHNQWGRLGIDEQEAEGNSMISQSVAMAI
AGTSVPQMSRPSSFLLNPQATRQHGTFSPESSRSLLICLLWVLKNADELVLQKWFTDLSV
SQLNRLLDMLYLCVSCFEYKAHFLFMQGKKAFERMNSLTFKKSKDMKAKLEEAILGSIGA
RQEMVRRSRGQLERSPSGSAFGSQENLRWRKDMTHWRQNSEKMDKGQRSVRFKESLQRNR
RSQDSLLDRTRAELEHEALIDGNLATEANLIILDTLEIIVQTVSVTESKESILGGVLKVL
LHSMACNQSALYLQHCFATQRALVSKFPELLFEEETEQCADLCLRLLRNCSSSIGTIRSH
ASASLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTSQNFNEEFLRRSLKTILTYAEEDL
ELRETTFPDQVQDLVFNLHMILSDTVKMKEHQEDPEMLIDLMYRIAKGYQTSPDLRLTWL
QNMAGKHSERNNHAEAAQCLVHSAALVAEYLSMLEDRKYLPVGCVTFQNISSNVLEESAV
SDDVVSPDEEGICSGKYFTEAGLVGLLEQAAASFSMAGMYEAVNEVYKVLIPIHEANRDA
KKLATIHGKLQEAFGKIVHQSTGWERMFGTYFRVGFYGSKFGDLDEQEFVYKEPAITKLA
EISHRLEGFYGERFGEDQVEVIKDSNPVDKCKLDPNKAFVQITYVEPYFDTYEMKDRITY
FDKNYNLRRFVYCTPFTLDGRAHGDLHEQYKRKTILTTSHAFPYIKTRINIIHKEEIISM
PIEVAIEDMQKKTQELAFATHQDPADAKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSD
PKLYRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLINR
KIPQLYKPVLQVSSHRDSFSRMSLRKLDA
NT seq 6390 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcgccgcgccttcgctcagaaaataagcaggactgtagctgcggaggtgagg
aagcagatcgctggtcagtatggaggttcccctcaactcctcaaaaatctccacatgggg
ggtaatgctgcgagcaactcggtgccattgactgaggcggtggagccagtggactttgag
gagtatttgatcactcatccacccattattgagtcgggacctctgagagacctcattgag
tttcctcaagatgatattgaagtcatttacacacccagggagtgccggacgctgggccag
gcagtgccagaggaaggtgataatgatgcacatgtccgtgactgtatcagatcctacact
gaggattgggccatcgtcaaccgcaagtaccataagctgggtacaggctttaacccaaac
acgttggacaagcagaaggagaggcagagaggtttacccaagcaggtgtttgagtcagat
gagctgccggaccccagcagctatcaggacgatcaggatgatctgaagcgcaggtccatg
tccatagatgacactcctcggggtagttgggcttgcagtatatttgacctgaagaactct
cagcctgatgctctgctccctcatctgctggaccgagtgccgaatgaggagatcgaccgg
cacaacgaggagcaacgcaaatccaacaggcaccgagagctcttcgctctgcacccggca
ctcgacgaggaggagccaattgagcggcactgtgttcctgatgttccaaaagagcacttt
gggcagagactgcttgttaagtgcttatccctgaagtttgagatcgagattgagccaata
tttgcaagtttggccttgtatgatgtcaaggaaaagaaaaagatatcagagaactttttc
tttgacctgaattcggagcagaccaaagccatgctgcgtcctcacatccagacagctgct
atctccaccctggcccgctccgccatcttctccatcacctacccctcccaagatgtcttc
ctggtcataaagcttgaaaaggttctacagcagggggatataggagaatgtgcagagcct
tacatggtcttcaaggagtcagatgctgccaaaaataaggagaagctggagaagctgcgt
gctcagtcggagcagttctgccagaggctcggtcgttacaggatgcccttcgcttggacc
gccatccatctgatgaacatagtcaacagtgctggcagtctggagagagacaccgagctg
gaaatgggcctgccagagaggaagggttcctggtctgagcggaggaactccagcattgtg
ggtcggcgctctttagagaggaccaccagtggggatgagtactgcaatctgaccagcttc
aggcctgctacactcaccgtcaccaacttcttcaaacaggaaggagatcggctaagcgat
gaggatctgtataagttcttggctgacatgaggcggccctcttcagtgttgcgcagactg
aggcctattacagctcagctgaagatcgacatctctcctgcacctgagaacccccactac
tgtttgactccagagctacttcaggtcaagccttatccagacacccgagtacggcccacc
agggagatcttggagttcccagccaaagacatctatgtgcccaacaccacgtacaggaac
ctgctgtatgtcaacccacagagtctgaattttgctaaccgccagggctccgctcggaac
atcacagtgaaggtgcagtttatgaacggggaggaccccagcaatgccatgcctgtgatc
ttcggtaaatccagctgtggagagttttcaaaagaggcatacaccgcggtggtctatcat
aaccgctctccagatttccatgatgaggtcaaaattaagctgccagcctccctgaacgac
caccatcacatcctgttcaccttctaccacgtcagctgccaacagaagcaaaacactcct
ctggagacaccagttggatacacgtggatcccgatgctgcagaacggacgtcttcgaaca
ggccacttctgcctgccagtatccctggaaaaaccaccgcagtcttattctgtactctct
cctgatgttcctctgcctggtatgaaatgggtcgacaaccacaggggagtgtttaacgtt
gaggtcgtatccgtgtccactatccacacccaggaccagtatctggataagttctttgcg
ctggtgcacgctctggacgagcacatgttcccagtgaggatcggggatatgcggatcatg
gagaacagcctggaagcagagctgaagggcagcatagcagctctgagctcctctcagctg
gaaccagtggtgcgcttcctccaccttctgctcgacaagctggtgctgttggtggtgcgg
ccccccgtcatcgccggacagatcgtaaatcttggccaggctgctttcgaggcgatggca
tccatagtaaaccgtctgcataaatatctggacaccagccaggacatgcacggccgcaac
agcctcctctcttcctacattcactacgtcttccgtctgcccaacatggaccctaactct
ccttccccaggtcctggaggcctgggcggctcggtgcactatgccacgatggctcgttct
gccatcagaccagccagcctcaacctcaaccgctcccgtagccttagcaacagtaaccct
gacatctctggcacgccaacgtctccggacgacgaagttcgttccattatcggcactaag
gccatggatcgcagtggcaatcgcatgtcatcgcacactgagagcgccagtttcttgcaa
actttaacaggacgcttgccgaccaaaaagctcttccatgaggaactggcactgcagtgg
gtggtgagcagtggcagtgtgagagaaggagcacttcaacaggcctggttcttctttgag
ctcatggttaaaagtataatccaccacttgtacttcgccgaccgtctggagtctcccagg
aagaaccgttttcctgagcgcttcatggatgacatcacagctctggttagcaccatcgca
ggagacatcgtctcacgcttccaaaaggatctggagttggtggagaggctcaacacaagc
ctggccttctttcttaatgacctgctgtctgtcatggacaggggcttcgtcttcagcctc
atcaaggcatactggaaacaggtgtccactaagctgtatgcactgcagaaccccactctg
gaatctctgaggctcgacttcctcaggatcgtgtgcagccacgagcactacgtcacgctg
aacctgccctgcagtctgctcactcctccagcctccccctctccctccgtctcctccgcc
acctcacagagctctggtttctccacccacgtgcaggaccagaagattgcgaatatgttc
gagttgtcagtaccctttagagaacagcactacctggctggtttggttctaaccgaactc
gccgtcattctggacccggaagctgatgggtcagtacactggatgttcggcttacataag
aaggtgatcagcgtggtccataacctgctgtccagtcatgactcggacccgcgctatgcc
gaccctgaggttaaagccagggtcgccatgctctacctacctctcattggcatcatcatg
gagaccctgtcccagctccatgacttcacagagtctcataaccagtggggtcgtcttgga
atagatgaacaggaagctgagggcaatagcatgatcagtcagagcgtagccatggcaata
gcagggacctctgttcctcagatgtcgcggcccagtagcttcctgcttaacccacaggcc
acccgtcaacacggcaccttctctcccgagtccagtcgcagtctgctcatctgtctgctg
tgggtgctgaagaacgcagacgagctggtgctgcagaagtggttcactgacctgtctgtg
tctcagctcaaccgcctgctggacatgctctacctctgcgtctcctgcttcgagtacaag
gcccattttttattcatgcagggaaagaaggcatttgagcgcatgaacagtctaaccttt
aagaagtctaaagacatgaaggccaagctggaggaggctatcctgggcagtatcggagcc
aggcaggagatggtgcgacgcagccgaggacagttagaacggagtccatcaggcagtgcg
tttggcagtcaagagaacctgcgctggaggaaggacatgacacactggcgccagaacagt
gaaaagatggacaagggccaaagatcagtcaggtttaaggaaagccttcagcgcaatagg
aggagccaggattccttgttagatagaaccagggcagagctggaacacgaggcactaata
gacggcaatctggcaactgaggccaacctcatcattctcgacactctggaaatcatagtg
cagactgtatctgtgaccgagtcgaaggaaagcattctcggaggcgtcctcaaagtcctg
cttcacagcatggcatgcaaccagagcgccctctatcttcagcactgcttcgcgacacag
agagctcttgtctcaaagttcccagagctgctgttcgaggaggagacggagcagtgtgct
gatctgtgtctgcgtctgctgaggaactgcagcagtagcatcggtaccattaggtcgcac
gccagcgcctcactttacctgctaatgagacagaactttgagattggaaacaactttgcc
agagtgaaaatgcaggtgacgatgtctctgtcgtccctggttggcacgtctcaaaacttt
aacgaggagttcctgagacgctcgctcaaaaccatcctgacctacgctgaggaggacctg
gagctccgagagaccacattccctgaccaggttcaggacctggtgtttaacctgcatatg
attttgtcagacacagtaaagatgaaggaacatcaagaggatccagagatgcttatcgat
ttgatgtacagaattgctaaggggtatcagacgtccccagatttaaggctgacctggctg
cagaacatggcagggaagcactcggagaggaataaccacgcagaggcggctcagtgtctg
gtccacagcgccgcacttgtagctgaatatctcagcatgctggaggatcgcaagtacctg
cctgtaggctgtgtcaccttccagaatatctcgtccaatgtactggaggagtctgctgtg
tctgatgatgtcgtgtctcctgatgaggaaggtatctgctcggggaaatatttcacagag
gccgggctggtggggctgttagagcaggctgccgcctccttctctatggctggcatgtac
gaggccgtgaacgaagtctacaaggtgctcatccctattcatgaagctaacagggatgca
aagaagctggccaccattcatggtaaactgcaagaggcctttggcaaaatagtgcaccag
agcactggctgggagcgcatgttcggtacttacttccgagtgggattttatggttctaaa
ttcggcgacttggacgagcaggagtttgtgtacaaagagccggcgatcaccaagctggct
gaaatctcacatcggcttgagggattctatggggagagatttggggaggatcaagttgaa
gtcattaaggactcgaatccagtggacaaatgcaaactggatccaaataaggctttcgtt
cagatcacttacgtggaaccgtactttgacacgtacgagatgaaggaccgcatcacgtat
ttcgacaagaactacaacctgcgccgcttcgtgtactgcacgccgttcacgctagatggc
cgcgcacacggagacctgcacgagcagtacaaacgcaagaccattctcaccaccagccac
gcctttccctacatcaaaacccgcatcaacatcattcacaaggaggagatcatctccatg
cctattgaggtggccattgaggacatgcagaagaagacacaggaactggccttcgctact
caccaggatccagctgatgccaagatgttacagatggtgctgcaggggtctgtgggtacc
acagttaaccagggcccacttgaggtcgctcaggtcttcctgtctgaaattccaagtgat
cctaaactctacagacaccacaataagctgagactctgctttaaagacttcaccaaacgg
tgcgaagacgccctccgcaaaaataagagtttgataggtcctgaccaaaaggaatatcag
cgggagctggagagaaattaccacaggctgaaagaggctcttcagccgctcattaacagg
aagatcccacagctctacaaacctgtgctccaggtcagctctcacagagactcctttagc
agaatgagcctccgtaagctcgacgcgtga

DBGET integrated database retrieval system