KEGG   Ictalurus punctatus (channel catfish): 108273128Help
Entry
108273128         CDS       T04658                                 

Gene name
cacng5
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit gamma 5
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04010  MAPK signaling pathway
ipu04260  Cardiac muscle contraction
ipu04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108273128 (cacng5)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    108273128 (cacng5)
   04261 Adrenergic signaling in cardiomyocytes
    108273128 (cacng5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ipu04040]
    108273128 (cacng5)
Ion channels [BR:ipu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   108273128 (cacng5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 DUF716 Claudin_3
Motif
Other DBs
NCBI-GeneID: 108273128
NCBI-ProteinID: XP_017337649
UniProt: A0A2D0S4G2
Position
12
AA seq 273 aa AA seqDB search
MSVCGRKALTLLSSVFAVCSLGLLGIAVSTDYWLYLEEGIIMPLNQSTEIRMSLHSGLWR
VCFLAGKEKGRCFTIEYVMPMNVQMTSESTVSVLKMIRSATPFPLVSLFFMFIGFVLSNI
GHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISNINDEMLNRTKTNEAYFSYKYGWSFA
FSAISFLLTEAAGVMSVYLFMKRYTAEELYRPHSNYYGPRLSNCSDYSAQFLHPDAWTRG
RSPSDISSEASLQMSSNYPALLKCPEHISSSPC
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgtgtgggaggaaggctctgacgctgctaagcagtgtgtttgcagtgtgcagt
ctgggtctgttgggaatcgccgtcagcacagactactggctctacctggaggagggaatc
atcatgcctctcaaccagagcacagagatacgcatgtccctccactcaggcctctggaga
gtctgcttcctggcaggaaaagagaagggacgttgcttcaccatcgagtatgtcatgcct
atgaacgtccagatgacatcagagtccacagtcagtgtcctgaagatgatccgctctgcc
acgccgttcccactggtcagtctttttttcatgttcatcggcttcgtcctgagcaacatc
ggccacatccgtccccaccgcaccatcctagcgttcgtctccggaatcttcttcattctc
tcaggtctttctctagtagttggtctggtgttatatatctccaacatcaatgatgagatg
ctgaacagaactaagacgaacgaagcctacttcagctacaaatacggctggtctttcgcc
ttttccgccatctccttcctgctcactgaggcggcaggcgtgatgtctgtctacctgttc
atgaagcgatacacggcggaggagctgtaccggcctcattcaaattactacgggccgcgt
ctcagtaactgctctgattactcggctcagttccttcacccggacgcctggacgcgagga
cgcagtccctcagacatctccagcgaagcctcgctccagatgagctccaattaccccgct
ctgctcaagtgtcctgagcatatttcctcttccccctgctga

DBGET integrated database retrieval system