KEGG   Ictalurus punctatus (channel catfish): 108273364Help
Entry
108273364         CDS       T04658                                 

Gene name
gmppa, gmppab
Definition
(RefSeq) GDP-mannose pyrophosphorylase A
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00051  Fructose and mannose metabolism
ipu00520  Amino sugar and nucleotide sugar metabolism
ipu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    108273364 (gmppa)
   00520 Amino sugar and nucleotide sugar metabolism
    108273364 (gmppa)
Enzymes [BR:ipu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     108273364 (gmppa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 DUF4954 DUF2967 Hexapep_2
Motif
Other DBs
NCBI-GeneID: 108273364
NCBI-ProteinID: XP_017338031
UniProt: W5UJC9
Position
12
AA seq 422 aa AA seqDB search
MLKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMLQHHIEACAKVPNMKEIILIGFYQ
PNEELNRFIASAQQEFKFSVRYLQEFAALGTGGGIYHFRDQILCGGPSAFFLMNADVCSE
FPLQDMLHFHHQHGNSHCGIILGTTANRKQSLNYGCMVENQETNEVLHFVEKPSTFVSDI
INCGIYLFTPKIFTHIGTVFQRKQEDRQLEEPPCARQLRELIRLEQDIFTMLAAQKQLYV
YKTQHFWSQIKSAGSAIYASRLYLNRYNETHPERLARYQEGGPKIIGNVYIHQTANIDST
AVLGPNVSIGKGVIIGAGVRVRESIVLHGATLQDHCCVLNSIVGWDSTIGRWARVEGTPS
DPNPNDPFAKIDSETLFRDGGLTPSITILGCNVNIPSEVLIRNSIVLPHKDLNRSFKNQI
IL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaggcagtcattctgatcggcggtcctcaaaaaggaactcggttccggcctctg
tcatttgaggtacccaaacctctcttccccgtggctggtgtgcccatgctccaacaccac
attgaagcctgtgccaaggttccaaatatgaaggagatcatactgattgggttttaccag
cctaatgaggagctgaaccgcttcatagcctctgcccagcaagagtttaaattctcagta
agatacctgcaggagtttgcagcacttggaacaggtggtggcatttaccatttccgagac
cagatcctgtgtggaggaccatctgcgttcttccttatgaatgctgatgtttgctctgag
tttcccctgcaggacatgctccacttccaccaccagcatggaaactctcactgtggaatt
attctaggcactacggctaacaggaaacagtctttgaactatgggtgcatggtggagaat
caggaaacaaatgaggtgcttcattttgtggagaaacccagtacttttgtaagtgatatt
ataaactgtgggatctacttattcaccccaaagattttcacccacatcgggacagtgttt
cagagaaagcaagaagacaggcagctagaggagcctccatgtgctaggcagttgcgagaa
ctgatccgcttggagcaggacatctttacaatgctggcagcacagaaacaactgtatgtc
tacaaaacgcagcacttctggagccagattaaatcagcaggctcggcaatatatgccagt
cgtttgtacctgaaccggtataatgagacacatccagaaagactggccagataccaagaa
ggaggccctaaaataatagggaacgtatacatccatcagacagctaatattgactccaca
gctgttctgggtcctaacgtctcgatagggaaaggtgtaataatcggtgcaggagttcga
gtgagagaatcaattgtcttacatggcgctacactgcaggatcactgctgtgtgcttaac
agcatcgtaggctgggacagtacaatcggaaggtgggcgagagtggaggggacgccgagt
gaccccaaccccaatgaccccttcgctaaaattgacagcgagacactgttcagagatgga
ggtttgacaccgtctattacaatactggggtgcaatgtgaatattccatccgaagtcctc
attcgaaactcgattgtacttcctcacaaggatctaaacaggagcttcaagaaccagatc
atcctctag

DBGET integrated database retrieval system