KEGG   Ictalurus punctatus (channel catfish): 108273570Help
Entry
108273570         CDS       T04658                                 

Definition
(RefSeq) band 3 anion exchange protein-like
  KO
K06573  solute carrier family 4 (anion exchanger), member 1
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ipu02000]
    108273570
   04147 Exosome [BR:ipu04147]
    108273570
   04090 CD molecules [BR:ipu04090]
    108273570
Transporters [BR:ipu02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   108273570
Exosome [BR:ipu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108273570
CD molecules [BR:ipu04090]
 Proteins
  108273570
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto PTS_EIIA_2
Motif
Other DBs
NCBI-GeneID: 108273570
NCBI-ProteinID: XP_017338339
UniProt: A0A2D0S6F6
Position
13
AA seq 840 aa AA seqDB search
MKNESEQGGLQETGRWQDYKQSHDPEVGLWESSHISYLTFKSLVQLRRTMDTGVVMLDRE
EPSLSSIMEKIVDEMVEKEEIRPVDREGVFKALTQNRSHSVEEQGLTSSVEIQTVSVAEK
SDAGEGVEASVVFVGTLDFLEKLTMAFVRLKEARVLEMSLETSVPVRFIFVLIGSTQNDV
DYHEIGRAMSALLADNVFKQAALKAQNDKELNDALTDFLDCSVVIPPTEIQDETMLAPII
GFQKKLLQERLHPSEPQSHLNPKADRRSSISKVPPPEDPLVRTGIPFGGLIRDLRRRYKH
YKSDITDARNAQVLAAVIFIYFAALSPAITFGGLLADKVDNMMGVSELMLSTAVQGVIFC
LISAQPVLVIGFSGPLLVFEEAFYGFCKSRDIEYIVGRVWIGVWLVVIVMLMVAIEGSFL
VRFISRFTQEIFSILISLIFIYETFAKLGSIFKAHPLNLNYEHLNTSVADPWHPIVFHQT
TVNNSTGNITTVTTIRYRAYPNTALLSMCLMFGCFSIAYFLRMFKNGYFLPGKVRRLMGD
FGVPIAIFLMVAVDISINDTYTQKLVVPKGLQVSNPAMRGWLINPMGEHKPFPTWMMFAC
AVPAILVFILIFLESQITTLIVSKPERKMVKGSGFHLDLLILVCMGGFSAFFGMPWLSAA
TVRSVTHANALTVMSKGPKPEIEKVLEQRISGVLVALLVGLSILMEPILKMIPMAALFGI
FLYMGVTSLSGIQLWDRMLLLLIPKKYHPNEPYAQRVKMSRMHMFTGIQIVCLAVLWIVK
SSLVSLALPFILILTIPLRVFLSRRVFTKLEMKCLDADDAKVTFEEEPGVDVYSETMMPS
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacgagagcgagcagggtggcctgcaggagacaggccgatggcaggattacaaa
cagagccatgatcctgaggttggcctctgggaatcttctcacatctcctacctgaccttc
aagagcctggtgcagctcagacggacgatggacaccggggtggtgatgttggacagagaa
gagccttcgctctccagcatcatggagaaaatcgtggatgagatggtcgagaaggaggag
atcagacctgtcgaccgtgaaggggtttttaaggctttaacgcagaaccgtagccattca
gtggaggaacagggtctgacatcatctgtagaaattcagacagtctcggttgcagaaaag
agcgatgcaggtgaaggtgtggaggcctccgtggtgtttgtggggactctggacttcctg
gaaaagctgaccatggcatttgtccgcctgaaggaagcccgagttctcgagatgtctctg
gagacttccgttcccgttcgcttcatctttgtgctgatcggatcgacccaaaacgacgtg
gactaccacgagatcggacgagctatgagcgcactcctggcagataatgtgttcaagcag
gcagcgttaaaagctcagaacgataaagagctgaatgatgcattgactgacttcctggat
tgcagcgtggtgatcccgcccacagagattcaggacgaaaccatgcttgcgcccatcatt
ggcttccagaagaagctcctgcaggagagactccacccctctgagcctcagagccatctc
aaccccaaagcagataggagatcgtctatttccaaagtgcctccgccggaggatccgctg
gtgcgcactgggataccgttcggaggactgatccgagatttgagaagacgctacaaacac
tacaagagtgacatcactgacgccaggaacgctcaagtccttgctgccgtaatctttatt
tactttgccgccctctcccctgctatcaccttcggcgggctgctagctgataaagtggat
aatatgatgggcgtatcggagctcatgctgtctacggcagtgcaaggtgtcattttctgc
ctgatttctgcccagccggtcctcgtcatcggcttctcgggaccgctgctggtcttcgaa
gaggccttctacgggttctgtaagtctcgggacatcgagtacatcgtaggtagagtgtgg
atcggggtgtggctcgttgtcatcgtcatgctgatggtagcgatagagggcagcttcctg
gtgcgcttcatctcccgcttcacccaagagatcttctccatccttatctccctcatcttc
atttacgagaccttcgccaaactcggcagtattttcaaggcccaccctcttaatctcaac
tacgagcacttgaacacctcagttgcagatccttggcatcccatcgtcttccatcagaca
actgtaaataattctacaggcaacatcaccacagtcactacaatccgttaccgtgcctac
cccaacacagcgctgctctccatgtgcttgatgttcggctgcttctccatcgcttacttc
ctgcgcatgttcaagaacgggtacttcctgcctggcaaggttcgccgtttgatgggtgat
ttcggtgtccccattgctattttcctcatggtagctgtggatatcagcattaatgacacc
tacacacaaaaactagtggtgcctaagggcttgcaggtgtctaaccctgccatgcgaggt
tggctcattaaccccatgggcgagcacaagcccttccccacatggatgatgttcgcttgc
gccgtgcccgccattctggtcttcatcctcatcttccttgaatcgcagatcactacgtta
attgttagtaaacctgagagaaagatggtgaaaggttcaggcttccatctggaccttctg
attttggtgtgcatgggagggttcagtgctttcttcggaatgccatggctcagtgctgcc
acagttcgctctgtaacacacgccaatgccctgacggtcatgagcaaagggcccaaaccg
gagatcgagaaggttctggaacagaggattagtggtgtattggtggccctcctcgtggga
ctgtccatcctcatggagcccattctgaagatgatccccatggcagctttgtttggaatc
ttcctctatatgggagtcacatctctgagtggcattcagctgtgggatcgcatgctgctg
ctccttattccaaagaagtaccaccccaatgaaccgtatgctcaaagagtgaagatgagc
aggatgcatatgttcacaggcatccagatagtgtgcctggccgtgctgtggatagtgaag
tcaagcctggtgtcactcgccctgcccttcatcctcatcctgaccatcccactgcgtgtg
ttcctcagtcgtcgcgtcttcaccaagctcgagatgaaatgtctggatgctgatgatgcc
aaagtgacatttgaggaggagcccggcgtggacgtgtactcagagactatgatgccatcg
taa

DBGET integrated database retrieval system