KEGG   Ictalurus punctatus (channel catfish): 108273580Help
Entry
108273580         CDS       T04658                                 

Definition
(RefSeq) atrial natriuretic peptide receptor 1-like
  KO
K12323  atrial natriuretic peptide receptor A [EC:4.6.1.2]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00230  Purine metabolism
ipu01100  Metabolic pathways
ipu04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108273580
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108273580
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ipu01001]
    108273580
Enzymes [BR:ipu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     108273580
Protein kinases [BR:ipu01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   108273580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase Peripla_BP_6 HNOBA DIRP
Motif
Other DBs
NCBI-GeneID: 108273580
NCBI-ProteinID: XP_017338424
UniProt: A0A2D0S6N9
Position
1
AA seq 1071 aa AA seqDB search
MRLLCWLKGGRFSVTPLLLLLLCCPSVSIHPRSSYPHEPHKPMHKQENITLAVILPKDNT
SYPWAWPRVGPALLRAIELINADSLLLPGYRLRHVFNNSENADGICSESVAPQMAVYLKF
THEPWAFIGPGCDYTASPVGLFTTHWGLPMITAGAPAVGFLRAEVYTSITNTGPTHKKLG
EFGLHLCRHFGWVQHALLMFGDSKMSERECYFAIEGLYVELHEANITTVDLVFEEDSKSI
NYSEHLHKIKEEGRVVFACCTPDIFRQLMVNFRKANLPQEEFVFIYIDVFGRTVASQPAR
PWARGDPDDDLAKEAYQSVKILTYREPQNPEYKDFVTDLKANAKKMFNFTVEDSLMNIIS
GGFYDGLMLYAHALNESLADSQGRLSRESVTKRMWNRTYYGVTGLVQIDDKGDRETDFAL
WDMTDTNSSIFEIVAVYNGTKKQMETLPDMAFHWPGGSVPPDMPFCGFKNDNPACIARTI
TMHQMVSIVMFFILVIIFNVTIFIYRKLKLEKELAAQLWRSFWEDLHMSNLEKVLRSAGS
KLTLSLRGSNYGSLPTADDNFQMFAKTAYFKGNIVAIKFVNRKRIELTRTVLFELKHMRD
VQNDHLTRFIGACMDPPNICIVTEYCPRGSLQDILENESITLDWMFKYSLINDIVKGMAF
LHNSVIVSHGNLKSSNCVVDNRFVLKITDYGLSSFRAESNSEDAHSYNARKLWMAPELLR
MGSPPAGGTQKGDVYSFGIILQEVALRRGVFYIEGETLSSKEIVDRVALGEWPYLRPAVN
TQAHSEELGLLMQRCWAEEPAERPEFSHIKVLLRKQNREHSRDILDNLLSRMEQYANNLE
ELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTAL
SAESTPLQIVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKIHACEIGRM
SLALLEAVKTFKISHRPDQQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESN
GEPLKIHVSSATHDVLQEFNCFHLELRGDVEMKGKGKMRTYWLLGETKSSE
NT seq 3216 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgctgtgctggttaaagggaggcaggttctctgtaaccccattgctgctgctc
ctgctctgctgtccttctgtttctatccatcccagatcttcttatccccacgagcctcac
aaacccatgcacaaacaggaaaacattacactggctgttattctgcctaaggacaatacc
tcatacccatgggcctggccacgtgtcggacctgccctactgcgtgcaatagaactcatc
aacgccgattctttgctcctgcctgggtacagactgcgacacgtttttaacaacagtgag
aatgctgatggtatttgctctgagtctgttgcgccccaaatggctgtgtacctgaagttc
actcatgagccatgggctttcattggcccaggctgtgactacacagcctctccagtgggc
ctcttcaccacacattggggtctacctatgatcacggcaggggcaccagcagtaggcttc
ctccgcgccgaggtctacacctctattactaacacaggccctacacacaaaaagctgggt
gagtttggccttcatctgtgtagacactttggctgggtccagcatgccctgttgatgttt
ggagacagcaaaatgagtgagcgtgagtgctattttgccatcgagggtctttacgtggaa
ttgcacgaagccaacatcaccacggtggaccttgtgtttgaggaggacagcaagtccatt
aactactctgagcatctgcataagataaaagaagagggcagagtggtgtttgcatgctgt
actccggatatctttcgacagctaatggtaaacttccgtaaggcaaatcttcctcaggaa
gagtttgtcttcatctacattgatgtttttggacgcacggtggcatcacaacctgcccgg
ccttgggccagaggagaccctgatgatgacctcgcaaaagaagcataccagagtgtgaaa
atcctgacgtacagagagccacagaatccagagtacaaagattttgtcactgatctgaaa
gcaaatgctaagaagatgttcaacttcacagtggaggactctctgatgaacataatatct
ggaggcttctatgatggcctaatgctgtatgctcacgcgctaaatgagagtttagcagac
agtcagggccgactgtcaagagaaagtgtcaccaaaaggatgtggaaccgaacatactat
ggtgtgaccggactcgtgcagatagatgataagggagacagagagactgactttgcttta
tgggacatgactgataccaactccagcatctttgagattgttgctgtgtataatggtact
aagaaacagatggagacgctgcctgacatggcctttcactggcccggaggcagtgttcct
cctgacatgcctttctgtggtttcaagaatgataaccctgcctgcattgcacggaccatc
acaatgcaccagatggtgtcaattgttatgttctttattcttgtcatcatctttaatgtc
accatcttcatatataggaagctgaagttagagaaggagctggctgctcagctctggcgg
agcttttgggaggatttgcacatgagcaatctggagaaggtgctgcgcagtgcaggcagc
aaactgaccctctccctgcgaggctcaaactacggctctctacccactgctgacgacaac
ttccagatgtttgctaagactgcctactttaagggaaacattgtggctatcaaatttgtc
aacaggaaacgcattgaactgaccaggacagtgctgtttgaactgaagcatatgcgggat
gtgcaaaacgatcatttaactcgctttattggggcatgcatggatcctcccaacatctgc
atagtcacagagtactgcccgcgaggcagtctgcaggacattctggagaatgaaagcatc
acactcgactggatgtttaaatactctctgatcaatgacattgtgaagggaatggccttc
cttcataacagtgtgattgtatcccatggtaatttgaagtcctcaaactgtgtggtggat
aaccgctttgtgctgaaaatcactgactatgggctgtcaagcttcagggctgaatccaac
agcgaggacgctcactcttacaacgcacggaagttgtggatggctccggagctgttgagg
atgggcagccctcctgcaggcggaacacagaaaggagatgtctacagctttggcatcatc
ctgcaggaggtggcactgcgcagaggcgtcttctacatagagggcgagacactcagctct
aaagagatagtggaccgtgttgctctgggtgagtggccgtacctgcggccagctgttaac
acccaggcacacagtgaggagttggggctcctgatgcagcgctgctgggcagaggagcct
gcagagaggccagagttcagccacattaaagtacttctgcgtaaacagaacagggagcac
agcagggatatcctggataacctgctgtctcggatggagcagtatgctaataatctggag
gagctggtggaggagaggacgcaggcttacctggaagagaagcgcaaggcagaagcccta
ctctaccagatactgccccattcagtggcagagcagctgaagaggggggagaccgtgcag
gctgaggctttcgactcagtcaccatatacttcagtgatattgtgggttttactgccctg
tctgctgaaagcacacctctgcagatagtgactctcctaaatgatctctacacttgtttt
gatgctattatcgacaactttgatgtttacaaggtggagacgattggtgatgcctacatg
gttgtctctggcctgccagtccgtaatgggaagatacatgcatgtgagattggccgcatg
tcccttgctctgcttgaggctgtcaaaacatttaagatttctcaccgaccggaccagcag
ctcaaactgcgcattggcatccacagtggccctgtgtgtgctggtgtagtaggcctaaag
atgcctcggtactgtttatttggagacacagtgaacacatcatcacgcatggagtccaac
ggcgagcccttgaagatccacgtgtcatctgccacacatgatgtgctgcaggaatttaac
tgcttccatctggagctgagaggagatgtggaaatgaaaggcaagggcaagatgaggacc
tactggctgctgggagagacaaaaagcagtgagtga

DBGET integrated database retrieval system