KEGG   Ictalurus punctatus (channel catfish): 108273659Help
Entry
108273659         CDS       T04658                                 

Gene name
minpp1
Definition
(RefSeq) multiple inositol-polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00010  Glycolysis / Gluconeogenesis
ipu00562  Inositol phosphate metabolism
ipu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108273659 (minpp1)
   00562 Inositol phosphate metabolism
    108273659 (minpp1)
Enzymes [BR:ipu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     108273659 (minpp1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     108273659 (minpp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708 Phage_TAC_3
Motif
Other DBs
NCBI-GeneID: 108273659
NCBI-ProteinID: XP_017338527
UniProt: A0A2D0S712
Position
13
AA seq 468 aa AA seqDB search
MHQRVLKMRPAVCRNRHFVIAALSMIMVRVSYCKLTKPSIPAIAFYFGTKGRYEEVNPHL
LDDIFFVNKSLVRPPAPECQAVHLVAVIRHGTRFPTTKNIKKIHRLYDVVMTEASGTDQW
LRDIQNNWTMWYTEDMDGKLVEKGKDDLRHLAVRLSKSFPTLIAEENLRRERMEFITSSK
HRCVDSIQAFQEGLLKHWDVGDVGFRHSVNDSLMRFFDQCKRFVEDVDHNKTALKEVQLF
KSSLEMDEVCRRMASRLQIPHSQITPDLVEAAFFLCSYEFAIKSKNSLWCNLLDELDAQV
LEYKNDLKQYWKRGYGYDINRKSSCILFHDLFRRLDQASYDYRFGEVNKAVTIQVGHGET
LLPLLSLMGFFRDETPLTAKNFRLQHSRKFRSSRIVPYAANLLFVLYECTDGLRLQFFLN
EKPVAFPNISAPAPLYRTVRNHYSDLLGGCDFKKECELPNGKVKNTEL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgcaccaaagagttttaaagatgagacccgcagtgtgcaggaacagacattttgtcatt
gctgctttgagtatgatcatggttcgtgtttcctattgtaagctcacaaaaccaagcatt
ccagccattgctttttactttgggaccaaagggcgatatgaggaagtgaacccacattta
ttagacgatattttcttcgtgaataaatctctggtgagacctccagccccagaatgtcag
gcagtgcacttagtggcggtgatcagacacggcacgcgcttccctaccaccaaaaacatt
aaaaagatccatcgcctgtatgatgttgtgatgactgaggcgtccggcactgaccagtgg
ctcagggacattcagaacaactggaccatgtggtacactgaggatatggacgggaagcta
gtagagaaagggaaagatgacctgagacatttggctgtgaggttgagcaagtcgtttccg
acgctgattgcagaagaaaacctccgcagagagcgcatggagttcataaccagctccaaa
cacaggtgtgtggacagcatccaggctttccaggagggactcctcaagcactgggacgtg
ggagatgtgggtttcagacactccgtgaatgattcactcatgcgcttcttcgatcagtgc
aaaagatttgttgaagatgttgaccacaacaagaccgccttgaaggaagtccaacttttc
aagtcgtctctggagatggatgaagtctgcaggcggatggccagtcgcttacagattcca
cacagtcaaataactccagatttggttgaagccgctttctttttgtgctcctatgagttt
gcaatcaagtctaagaattctctgtggtgtaacctgctggatgaattggatgctcaggtc
ctggaatacaaaaatgatctgaaacagtattggaaaaggggatatggctacgacatcaac
cgcaaatcgagctgtattctctttcatgacctcttcaggaggcttgaccaggcatcgtat
gactacaggtttggagaggtgaataaggcagttaccatccaggtgggccatggtgagact
ctgctgcctctgctgtctctcatgggtttcttcagggacgaaacaccactaacggccaag
aacttccgtttgcagcacagtcgcaagttccgcagcagtcgaatagtgccttacgccgca
aacctgctctttgtcctatatgagtgtacagatggactccggctccagttcttcctcaat
gagaaaccagtggcttttcctaacataagtgccccagctccattgtataggacagtcagg
aaccactactctgacctcctgggtggctgtgattttaagaaagaatgtgaattgccaaat
ggtaaagtcaagaatactgaactgtga

DBGET integrated database retrieval system