KEGG   Ictalurus punctatus (channel catfish): 108274677Help
Entry
108274677         CDS       T04658                                 

Gene name
mars2
Definition
(RefSeq) methionyl-tRNA synthetase 2, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00450  Selenocompound metabolism
ipu00970  Aminoacyl-tRNA biosynthesis
ipu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    108274677 (mars2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    108274677 (mars2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ipu01007]
    108274677 (mars2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ipu03016]
    108274677 (mars2)
Enzymes [BR:ipu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     108274677 (mars2)
Amino acid related enzymes [BR:ipu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   108274677 (mars2)
Transfer RNA biogenesis [BR:ipu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    108274677 (mars2)
 Prokaryotic type
   Other AARSs
    108274677 (mars2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-GeneID: 108274677
NCBI-ProteinID: XP_017340401
UniProt: A0A2D0SD61
Position
14
AA seq 670 aa AA seqDB search
MNNNKVNELSQAFIIGLLVLNLFPFTLTDQLAACEYTTSQSQRRRRGLFSFFLCPCGEKH
SPPGSTLTRAPLTFTMSSQSSVLQSKGRLLLQVLKYGSRGEQTCFYPSLPAKRLHTHLVL
RCTRTGESRRSYYITTPIFYVNAAPHIGHVYSAVTADCLHRYQLLQGVNSRFATGTDEHG
LKIQQAASAAGKDPLLFCTEVSGRFRDVFQSCNIAYTDFVRTTEDRHRRAVEHFWAKLLD
KGFIYKGTYEGWYSTPDESFLAPGQVTESTDSTGREIKISTESGHKVEWMKEHNYLFRLS
DFRTSLQEWLRSNPKAIQPEKFYHLVLQWLETELPDLSVSRQRSRLQWGIPVPGDPEQTI
YVWLDALVNYLTVAGYPEKYSRWWNVVHHVVGKDILKFHAIYWPAFLMAAELPLPQAIYV
HSHWTVQGKKMSKSLGNVVDPLESSERFTVDGLRYFLLRQGVPDIDCDYDDDKVVKLCNS
ELADSLGGLLNRCAAPSLNPEQVYPPFCSVSFPKESGGRAVSEDYKLVAAVSGLPVSVKQ
NFDQLRMYKALEAISVCVRLTNSFVQRHAPWKLDRTDPEDKLWHDTILHVSMECLRIYGI
LLQPAVPVVADKILSRLGVRSDERSWDNALDFLSKYEGKHCPYEGRALGPDTGVLYNRIE
RSKPNQKAEK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaacaaagttaacgaactcagtcaggcttttattatcggactcttagtattg
aacctctttcccttcacacttactgaccaattagcagcttgtgagtatacaactagccaa
tcacagcgcaggaggcggggtttgttctctttttttctgtgtccgtgtggagagaaacac
tcccctcccggaagtacactgactcgagcgcctctcactttcacaatgagctctcaaagt
tcagtcctccaaagcaagggaagacttttgttacaggtgttaaaatacggctcgcgcgga
gaacaaacctgtttttatccatcacttccggcaaagaggctgcacacacacctggttttg
cgatgcacgcgcacaggagagtcgcggaggtcatattatatcaccacaccgatcttctac
gtgaacgcggcgcctcacatcggacacgtttattccgccgtgacagccgactgtttacac
cgataccaactcctgcagggggttaactccaggtttgctacaggtaccgacgaacacggg
ctgaagatccagcaggcggccagcgccgccggtaaagacccgctgcttttctgcaccgag
gtgtcaggcaggtttcgcgacgtgttccagagctgtaatatcgcatacaccgactttgtg
cggacgacggaggacagacacagacgggcggtggaacatttctgggccaagctgctggat
aaaggcttcatctataaaggcacttacgaaggctggtactccacaccagacgagagcttt
ctcgcacccggccaagtgaccgagagcacagactccacgggcagagagatcaaaatctcc
accgagagcggacataaggtggagtggatgaaggagcacaactacctgttccgcctctct
gatttccgaaccagtcttcaggagtggttaaggtcaaaccccaaagccattcagccggag
aagttttaccatcttgtccttcagtggttggagaccgagctacccgatttatcagtgtcg
cgtcagagaagccgtctgcagtggggcatcccggttcctggagatcccgaacaaacgatc
tacgtgtggctggacgctctggtgaactacctgactgttgcgggttatccagagaaatac
tcgcggtggtggaacgtcgtccatcacgtcgtaggcaaagatattttgaagttccacgcc
atatactggccagcgtttcttatggctgcggaactgcccctccctcaggccatatacgtg
cactcccattggacggtgcagggaaagaagatgtccaagagtctcggaaacgtagtagat
ccgctcgagagctcggaaaggttcacggtggacgggctgaggtattttctactcaggcaa
ggggtcccagatatcgactgcgactacgacgacgacaaggtggtgaagttgtgcaacagc
gagctggccgattctctcggtggtcttctcaaccgctgcgccgcaccctcactcaacccg
gagcaggtctatcctccgttctgcagcgtctcctttccaaaagagtccggcggaagagcc
gtgtcggaggattacaaactggtggcggccgtttcagggctccctgtttcggtgaagcag
aactttgaccagctgcgcatgtataaagcactggaagccatcagcgtgtgcgtacgtctg
accaacagcttcgtccagcgacacgcgccatggaagctcgaccgcactgaccccgaggat
aaactctggcatgacaccatactgcatgtgtctatggagtgtctcaggatctacggcatt
ctcctgcagcccgccgtgcctgtagtagcagataaaatcctgtccaggctgggggtcagg
tccgacgagaggagctgggataacgcactcgacttcctgtccaagtatgaaggaaaacac
tgtccttacgaaggaagagcgctaggtccagacactggcgtgctttacaatcgtattgag
aggagcaaaccgaaccaaaaagcagaaaaatga

DBGET integrated database retrieval system