KEGG   Ictalurus punctatus (channel catfish): 108274869Help
Entry
108274869         CDS       T04658                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit-like
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04010  MAPK signaling pathway
ipu04260  Cardiac muscle contraction
ipu04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108274869
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    108274869
   04261 Adrenergic signaling in cardiomyocytes
    108274869
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ipu04040]
    108274869
Ion channels [BR:ipu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   108274869
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 108274869
NCBI-ProteinID: XP_017340812
UniProt: A0A2D0SDK9
Position
2
AA seq 284 aa AA seqDB search
MLLCDRGVQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCKTKVNHENETSRKNEEVMTH
SGLWRTCCLEGTFRGVCKKIDHFPEDADYKQDTAEYLLRALRASSVFPIMSVGLLFMGGL
CVAASEFYRSKHNVILSAGIFFVSAGLSNIIGIIVYISANSGDPGQSDSKKSYSYGWSFY
FGALSFIMAETVGVLAVHMFIEKHRKQQRAKTLVKKSSLGFGRIPTYRYRFGRRSSETPS
RDVPMFTLSRDSDKTAAGKLLDSDRDFLHNSNAKDAANRRTTPV
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgtgtgaccgaggcgtgcagatgctcatcactacagtgggcgcttttgccgcc
ttcagcctcatgaccattgcggtgggtacagactactggctttactccagaggagtgtgt
aaaaccaaagtcaaccatgaaaacgaaacgagcaggaaaaacgaagaagtgatgacccac
tccggattgtggagaacctgctgcctggaagggacattccgtggggtgtgtaagaagatt
gatcactttcctgaggatgctgattataaacaggacacagctgagtatttactgcgtgca
ctcagagcctccagtgtgtttccaatcatgagtgtgggtttgttgtttatgggcggattg
tgtgtagcagcgagcgagttttacaggagcaaacacaatgtcatcctcagtgccggaatc
ttctttgtctctgctggtcttagtaacattatcgggataattgtctacatctcggctaac
tcaggtgatccaggtcagagtgactcaaagaagagttactcgtacggttggtccttttat
tttggtgctctttccttcatcatggctgagacagtgggggtgcttgctgtgcacatgttt
attgaaaaacatcgcaagcagcagcgtgccaagacactcgtcaaaaagtccagtctcggc
tttggtcgcatccccacttaccgttatcgtttcgggcgccgctccagtgaaacaccatca
cgcgatgtccccatgttcacgctctcacgcgactctgacaaaactgccgcggggaagctg
cttgactctgacagagacttcctgcacaactctaatgctaaggatgcagccaatcggaga
acaacaccagtgtga

DBGET integrated database retrieval system