KEGG   Ictalurus punctatus (channel catfish): 108275350Help
Entry
108275350         CDS       T04658                                 

Definition
(RefSeq) venom phosphodiesterase 1-like
  KO
K01513  ectonucleotide pyrophosphatase/phosphodiesterase family member 1/3 [EC:3.1.4.1 3.6.1.9]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00230  Purine metabolism
ipu00240  Pyrimidine metabolism
ipu00500  Starch and sucrose metabolism
ipu00740  Riboflavin metabolism
ipu00760  Nicotinate and nicotinamide metabolism
ipu00770  Pantothenate and CoA biosynthesis
ipu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    108275350
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108275350
   00240 Pyrimidine metabolism
    108275350
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    108275350
   00760 Nicotinate and nicotinamide metabolism
    108275350
   00770 Pantothenate and CoA biosynthesis
    108275350
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ipu04090]
    108275350
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ipu00537]
    108275350
Enzymes [BR:ipu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     108275350
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.9  nucleotide diphosphatase
     108275350
CD molecules [BR:ipu04090]
 Proteins
  108275350
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ipu00537]
 Enzymes
  108275350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Somatomedin_B Phosphodiest ETRAMP
Motif
Other DBs
NCBI-GeneID: 108275350
NCBI-ProteinID: XP_017341615
UniProt: A0A2D0SH65
Position
14
AA seq 211 aa AA seqDB search
MDFNKALKNNRKRIIIGTLAVSVVTIILGLGLGLGLQLQKCKNKLPDTCRNRCYTPYDYE
TPGCRCDEQCVNSNSCCYDFADICLQPIESWECTALRCGEKRVSGSKCHCSSDCVSAGDC
CTNYGIVCNGMTPWVQDQCVSMSSPKCPANYKRQPLLLISLDGLRAEYQQTWHSLIPVLD
KLRKCGTSSAFMQPVFPSKTFLNHYSIVTGL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggacttcaataaggcactgaaaaacaacaggaaacgcattattataggaactttagct
gtatctgttgtgaccatcatattaggactgggtctagggcttggacttcagctgcaaaag
tgcaagaacaagttgccagatacatgtcggaaccgctgttatacgccgtatgattatgag
actccaggctgtcgatgtgatgagcagtgtgtgaacagtaacagctgctgttatgatttt
gcagacatctgcctccagccgattgagagctgggagtgtacagcattgcgttgtggggaa
aagcgtgtctctggtagtaagtgtcactgctcttctgactgtgtgagtgctggagactgc
tgtacgaactatggcattgtttgcaatggaatgacaccatgggtgcaggatcagtgtgtg
agcatgagcagccctaagtgtcctgctaattataagaggcagcctctgctgctcatctct
ctcgatggattaagagcggagtatcagcagacatggcactccctcattccagtcttggac
aagctacgaaaatgtggaacgtcctcagcatttatgcagcctgtatttccaagtaaaacc
ttcctgaaccactactccattgttacgggtctttag

DBGET integrated database retrieval system