KEGG   Ictalurus punctatus (channel catfish): 108276007Help
Entry
108276007         CDS       T04658                                 

Gene name
gpx7
Definition
(RefSeq) glutathione peroxidase 7
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00480  Glutathione metabolism
ipu00590  Arachidonic acid metabolism
ipu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    108276007 (gpx7)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108276007 (gpx7)
Enzymes [BR:ipu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     108276007 (gpx7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 108276007
NCBI-ProteinID: XP_017342740
UniProt: W5UDB1
Position
15
AA seq 186 aa AA seqDB search
MKLILRALALLLLSYLTEAKQKDFYTFKVVNSRGRLVSLEKYRGSVSLVVNVASECGYTE
EHYTDLQQLQRDFGPYHFNVLGFPCNQFGQQEPGSDVEIDSFVRRVYGVSFPLFSKIAVV
GTGANNAFKYLAEVTRKEPDWNFWKYLIDVDGKVVGSWGPQVSVKEIRPKITEMVRKLII
KRKEEL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgatcctccgagcgcttgctttactcctcctgtcttatttaacggaggcgaaa
cagaaagacttttacacgtttaaagtggtgaacagcagaggaagattagtttctctggag
aaataccgcggctcggtctccttggtggtaaacgtagcgagtgaatgtggctacactgag
gagcactatacggacctgcagcagctgcagcgggattttggaccgtaccatttcaacgtg
ctggggttcccgtgtaatcagtttggccagcaggagcccggcagcgacgttgagatcgac
agctttgtgaggcgtgtttatggagtctcgtttcctctcttcagcaaaatcgctgtggtg
gggaccggggccaacaacgcctttaaatacctcgcagaagtgacaaggaaggagcctgac
tggaatttctggaagtatctgattgatgttgatggtaaagtcgtcggttcgtggggtcct
caagtgtccgtgaaggaaattcggccaaagatcacagagatggtgcgcaaactcatcatc
aaacgcaaggaggagctgtag

DBGET integrated database retrieval system