KEGG   Ictalurus punctatus (channel catfish): 108276901
Entry
108276901         CDS       T04658                                 

Gene name
tm7sf2
Definition
(RefSeq) transmembrane 7 superfamily member 2
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00100  Steroid biosynthesis
ipu01100  Metabolic pathways
Module
ipu_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    108276901 (tm7sf2)
Enzymes [BR:ipu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     108276901 (tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 108276901
NCBI-ProteinID: XP_017344474
UniProt: A0A2D0SP45
Position
16
AA seq 421 aa
MKSSKHKSPQTTDTEFGGVIGAACIIVFLPLTVLFLLSVCVSEEGSVLRWPPPLPPHSDL
YDPRAVFIITVWFSTHILLYLLPVGKVSEGLVLRDGSRLKYPINGFHALCVTIVLVCMCV
CVGVPLAHLYDLMVPLAVCAVGVAFLLSLYLYARSFWAPVHALALGGNTGNAVYDFFIGR
ELNPRIGSFDLKYFCELRPGLIGWVVLNAVMLMKEVELRGSPSVSMLLVNAFQLLYVTDA
LWNEEAVLSTMDIVHDGFGFMLAFGDLVWVPFTYGLQAAFLVSHPHTLTPFSALAIILLN
GIGYYVFRKSNSQKNQFRRDPTHTSVRNLKTIATATGKQLLVSGWWGFVRHPNYLGDLLM
ALAWSLPCGFSHILPYFYVLYFSVLLVHREARDERQCRAKYGAAWEAYCSRVPYRIIPYI
Y
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgaagtccagcaaacacaaatcaccacaaacaactgacacagagtttggaggggtgata
ggtgctgcatgtataatagtgttcctccccctcactgtgctcttcctgctgagtgtgtgt
gtgtctgaggagggcagcgtgctccgctggccccccccactgcccccccactctgacctc
tatgacccccgagccgtgttcatcatcactgtgtggttcagcacacacattctgctctac
ctgctcccagtgggcaaggtgtcagagggtttagttctcagggatggaagcagactgaaa
tatccgataaacgggttccatgcgctgtgtgtgacgattgtgttggtgtgtatgtgtgtg
tgtgtgggcgtacccctggctcacctgtatgacttgatggtgccgttggcggtgtgtgca
gtgggcgtggccttcctgctctccctctacctgtatgctcgctccttctgggctcctgta
cacgcactggcactcggaggaaacacaggtaacgctgtgtatgatttctttattggacgg
gagttaaacccacgtatcggttcattcgatctgaaatatttctgtgagctgcgtccaggg
ttaataggctgggtggtgctgaatgcggtgatgttgatgaaggaggtggagctgcgtgga
tcaccatcagtgtcaatgctgctggtgaacgccttccaattactctacgtcactgacgct
ctgtggaacgaagaggcggtattgagcaccatggacattgtgcatgatggattcggcttc
atgttggcgttcggtgatttggtttgggttccgttcacatacggcctccaggcagccttc
cttgtgtcacaccctcatacacttactcccttcagtgcccttgccatcatcctgctgaat
ggaatcgggtattacgtcttccgcaagtccaactctcagaagaaccagttcaggagagac
ccaacacacactagcgtccgaaatttaaagacgattgccacagcaacaggaaagcagttg
ttagtgtcgggatggtgggggttcgtcagacaccccaattacctcggagaccttctgatg
gcgctagcatggtctctaccctgtgggttctcccacatcctgccgtacttctacgtgctg
tacttcagcgtgttgttggtgcacagggaggcacgagatgaacgtcagtgcagagcgaag
tacggcgcggcttgggaggcgtactgcagccgagtgccctacaggatcatcccctatatc
tactga

DBGET integrated database retrieval system