KEGG   Ictalurus punctatus (channel catfish): 108276965
Entry
108276965         CDS       T04658                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1-like
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ipu01002]
    108276965
Enzymes [BR:ipu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     108276965
Peptidases and inhibitors [BR:ipu01002]
 Metallo peptidases
  Family M1
   108276965
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 108276965
NCBI-ProteinID: XP_017344652
UniProt: A0A2D0SPM2
Position
16
AA seq 925 aa
MLQFIVLIIFISLVPPINSKDKNKTFVTADSSFPWKLRLPDTVKPVHYDLLIHPNLTFLN
FTGRVQIKLEVQQDTEHILLHSKNLHISKAVVLQSGDGHVLHVHESEPFEQISLSSQNFM
FLKGVHVIQLDFSANLSNSFHGFYKGSYTTRHGEIRALASTQFEPTHARAAFPCFDEPAF
KANFSIRIRREPRHISISNMPKLKTVALTADLLEDHYDVSVKMSTYLVAFIVCDFVSISK
RSQHGVQISVYTVPEKINQAEYALNTAVTLLDFYDDYFAIPYPLPKQDLAAIPDFQSGAM
ENWGLTTYRESGLLFDPERSSTSDKLGITKVIAHELAHQWFGNLVTMQWWNDLWLNEGFA
KFMEFVSTNITYPELQVNDYFLEKCFTAMSVDSLSSSHPISTSVENPAEIHEMFDDVSYQ
KGACVLNMLRDFLTPEVFNLGIIRYLKKHSYQNTVNADLWYSLTNICDSDDFDFGTLNTN
GFCTDSKSRPSASKWYMEDDLNVKVIMDTWTLQEGFPIIIVNVNGREVKLKQERYLKGAD
TSKNSSFLWQVPLTYITSSSNSVQRFLLKTRNDVLYLPAQVEWIKFNVDMRGYYIVHYED
QGWEALIRQLQHNHTVFSGNDRASLIHDIFQLVKIGKVTLDKALSMSLYLKHETEIMPVT
QGFSELVPLYKLMEKRNMAALEHQMKAYLVNLFQGLIDTQTWSDEGSVSERILRNYLLLF
ACVRRYAPCVTTAQELFLKWKESGGNMRLPADIRLVVYTEGARTEEGWDFLMELYRYTMY
PSEKSHIKAALAYSPLAHKLEWLMKKGLEGEVLKTHELPSLVISVSKNPNAYKLAWNFLR
ANWQELVKKFDLGSSSVSRMVVGVTNQYSTKEMLEEVRSFFRSLQVDMGSGLRSIQQALE
YIEENIRWMNRNIPLLKDWLNSHSA
NT seq 2778 nt   +upstreamnt  +downstreamnt
atgctgcagttcatcgttcttatcattttcatttctctcgtccctcctattaattccaag
gacaaaaacaagacctttgttacagctgattcctcgttcccatggaaactgagattacca
gacacagtaaagccggttcactacgatttactaatacatccaaacctgactttcctcaat
tttactggaagagtacagattaagttggaagtacagcaggacaccgagcacattcttctt
cacagcaagaatcttcacatctccaaagcagttgttttgcagtctggcgatggtcatgtt
cttcatgtccatgagtctgagccatttgaacagatttcattgtcttctcagaactttatg
tttctgaaaggagtacatgttatccaattagatttctcagctaacctgtccaacagtttt
catggcttttataaaggctcatataccacacggcatggtgaaattagggctttggcatct
acccagtttgagcctacacatgctcgtgctgctttcccctgctttgatgaaccagccttc
aaagccaacttttctatccgcatacgccgggaaccaaggcacatttccatttctaacatg
cctaagttgaaaacagtggcgctcacagcagatttgctggaggatcactatgatgtgagt
gtgaagatgagtacttatctagtggccttcattgtttgtgactttgtctccatcagtaag
agaagtcagcatggtgttcagatatctgtatacactgttccagagaagattaatcaagca
gaatatgccctcaacacagcagtaacacttcttgacttttatgatgattactttgccatc
ccatatccacttcccaaacaagatcttgcggcaattccagactttcagtccggtgctatg
gagaactggggcttgaccacatatagagaatccgggctcctctttgaccctgaaaggtct
tctacctctgacaaactgggcatcacaaaggttattgcccatgagcttgcccatcagtgg
tttggtaacttggtgacaatgcagtggtggaatgacctgtggttaaatgagggctttgcc
aagttcatggaatttgtatccaccaacatcacctatcctgagttgcaagtgaatgactac
ttcttagagaagtgtttcactgcaatgagtgtggattctttaagctcctcgcaccccatc
tcaacctctgtggaaaatcctgcagagatccatgaaatgtttgatgatgtatcctatcag
aagggggcctgtgttttgaatatgctgagagattttctgaccccagaagtgtttaatctt
gggattatacgttatctgaagaaacacagctaccagaatactgttaatgctgatctctgg
tacagtttgacaaacatctgtgactcagatgattttgactttgggacactgaatacaaat
ggattctgcactgatagcaagtccagaccttctgcttctaaatggtatatggaggatgac
ctgaatgtgaaggttatcatggacacctggacactgcaggagggttttcccattatcatt
gtgaatgtcaacggtcgagaggtcaaactaaaacaggaaaggtaccttaaaggggcagat
acatcaaagaattcaagcttcctttggcaagtccctttgacctacatcaccagcagctcc
aactctgtccagcgttttctgctgaagactagaaacgatgtattgtacttgccagcgcaa
gtggagtggatcaaattcaatgtggatatgagaggttattatattgtgcattacgaagat
cagggctgggaagctttgatcaggcaacttcaacacaatcacacagtttttagtgggaat
gacagagcaagcctcattcacgacatcttccagctggtcaaaattggaaaggtcactctg
gataaggccctgagcatgagtctgtacctgaagcatgagactgagatcatgccagtgacg
cagggcttcagtgaactcgtccctctttacaaactcatggaaaagagaaacatggcagca
ctggagcaccagatgaaggcctacttagtgaacctgttccagggactgattgacacacag
acatggagtgatgagggctcagtttcagagaggatcttacggaattacttgctcctcttt
gcatgtgtgcgccgttatgcgccctgtgttaccactgctcaggaacttttcctcaagtgg
aaggagtcaggtggcaacatgaggttgcctgctgatatccgcttggttgtttacactgag
ggtgctcgaacagaagaaggttgggacttccttatggaattgtaccgttacacaatgtat
ccctctgaaaagagtcatattaaagcagcactggcctacagcccactggctcacaagcta
gagtggctaatgaagaagggactagaaggagaagtcctgaagacccatgagctgccatca
cttgtcattagtgtcagtaaaaacccaaatgcatataaactggcatggaacttcctacga
gccaactggcaagaactggttaagaagtttgatcttggttcctcttcggtctcacgtatg
gttgttggagtaactaatcagtactcgaccaaggagatgctagaagaggtacggtctttc
ttcagatcactgcaggtagacatgggttcaggactgcgtagcatccagcaggccctggag
tatattgaggagaatatccgctggatgaacaggaatattccacttcttaaagactggctg
aacagtcacagtgcctga

DBGET integrated database retrieval system