KEGG   Ictalurus punctatus (channel catfish): 108277027Help
Entry
108277027         CDS       T04658                                 

Gene name
bmpr1b
Definition
(RefSeq) bone morphogenetic protein receptor type 1B
  KO
K13578  bone morphogenetic protein receptor type-1B [EC:2.7.11.30]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04060  Cytokine-cytokine receptor interaction
ipu04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    108277027 (bmpr1b)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108277027 (bmpr1b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ipu01001]
    108277027 (bmpr1b)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ipu04090]
    108277027 (bmpr1b)
Enzymes [BR:ipu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     108277027 (bmpr1b)
Protein kinases [BR:ipu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   108277027 (bmpr1b)
CD molecules [BR:ipu04090]
 Proteins
  108277027 (bmpr1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS Activin_recp FTA2 DUF5367 APH
Motif
Other DBs
NCBI-GeneID: 108277027
NCBI-ProteinID: XP_017344778
UniProt: A0A2D0SQ02
Position
16
AA seq 613 aa AA seqDB search
MRCPAAYLMPRPDRPRAEEKPLKTRRVLRPSVWSSGGDSGAAGMCGGQSFGWRRTHTLVP
RFSEQVAEGSLMARLLLLLLLPLLPGFSSNFTHANVLDAMLLRNSGKVTLDSRKEDSRSS
VPVLPERTLWCHCYHHCPEDSVNNTCRTDGYCFTMVEEEEGGPPTLTSGCLGLVGSEFQC
RDTGNSRLRRALECCTDQDYCNRDLHPTLPPINTPNYVDNSIHQMALFISVAVCSIILIF
IIVFCYFRYKRQELRPRYTIGLEQDETYIPPGESLKDLIEQSQSSGSGSGLPLLVQRTIA
KQIQMVKQIGKGRYGEVWMGRWRGERVAVKVFFTTEEASWFRETEIYQTVLMRHENILGF
IAADIKGTGSWTQLYLITDYHESGSLYDYLKSTTLDTRALLRLAYSAVSGLCHLHTEIFG
TQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVKFISDTNEVDIPPNTRVGTKRYMPPE
VLDETLNRNHFQSYIMADMYSFGLILWEIARRCVSGGIVEEYQLPYHDQVPTDPSYEDMR
EVVCIKRQRPSFANRWTSDEHTSTIQMCMKQQCLRQMGKLMSECWAHNPGSRLTALRVKK
TLAKMSESQDIKL
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgcgatgtcccgctgcgtatctaatgccacgtcctgacagaccgagagctgaggaaaag
ccgttaaagacgaggcgcgtgctgaggccatcagtgtggagtagcggaggagacagtggt
gcagcgggcatgtgtggcgggcagagtttcggctggagacgcacacacacactcgtgccc
cggttctcggagcaggttgctgaaggctctctgatggcccggctactgctgctgcttctt
cttcctcttctgccgggattcagctctaacttcactcatgcgaacgtgctggacgcgatg
ctgttgaggaattctgggaaggtgacgctggatagccgaaaggaggacagtaggagctca
gtgcccgtgctgcctgagaggacactgtggtgccactgttaccaccactgtccagaggac
tccgtcaacaacacctgcagaactgatggctactgcttcaccatggtggaggaggaagag
ggcgggcccccgacgctcacctcaggctgtttgggattggtgggctctgaatttcagtgc
agggatacggggaactctcgtttgaggagggcgctggagtgctgtactgaccaggactac
tgcaaccgagaccttcacccgaccctgcctccaatcaacacgcctaattacgtggacaac
agcatccaccagatggctctgttcatctctgtggcagtgtgcagcatcatcctcatcttt
atcattgtgttctgttacttcaggtacaaacgtcaggagctgaggccccgctatactatc
ggtctggagcaggatgagacctacatccctccaggagagtctctgaaggacctgatcgag
cagtcgcagagttcaggcagtggctcgggactccccctgctggtgcagcgcaccatagct
aagcagatccagatggtgaaacagatcggaaagggacgctacggggaggtgtggatgggc
cgctggagaggtgagagggtggctgtcaaggtgttcttcaccactgaggaggccagctgg
ttccgagagaccgagatttaccagaccgtcctcatgaggcatgagaatatactaggcttc
atcgcggcagatataaagggaacaggttcatggacgcagctgtacctgatcacggactac
cacgagagcggctctctctacgactacctcaaatccaccacgctggatacgcgggcactg
ctgcgcctggcgtactcggccgtctcagggctctgccacctgcacaccgagatcttcggc
acacagggcaaaccggccatcgcccaccgtgacctcaagagtaagaacattctggtgaag
aagaacggcacgtgctgcatcgccgacctcggcctagccgtcaagttcatcagtgacacc
aacgaggtggacattcctcctaacacacgcgtgggcaccaagcgctacatgcccccggag
gtactggacgaaaccctgaaccgcaaccactttcagtcctacatcatggctgacatgtac
agcttcggcctgatcctgtgggagatcgccaggagatgtgtgtcaggaggaatcgtggag
gagtatcagttgccttaccatgaccaggtacccacagacccgtcctatgaggatatgaga
gaagtggtgtgtataaagagacagcggccctcttttgccaaccgctggaccagcgacgag
catacctctactatacagatgtgcatgaaacagcagtgcctgaggcagatgggcaagctg
atgagcgaatgctgggcacacaacccaggctcccgcctcaccgccctaagggtaaagaaa
actctggccaaaatgtccgagtcgcaggacattaaactgtga

DBGET integrated database retrieval system