KEGG   Ictalurus punctatus (channel catfish): 108277666Help
Entry
108277666         CDS       T04658                                 

Definition
(RefSeq) heat shock cognate 71 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu03040  Spliceosome
ipu04010  MAPK signaling pathway
ipu04141  Protein processing in endoplasmic reticulum
ipu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    108277666
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108277666
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108277666
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108277666
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ipu01009]
    108277666
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ipu03041]
    108277666
   03009 Ribosome biogenesis [BR:ipu03009]
    108277666
   03110 Chaperones and folding catalysts [BR:ipu03110]
    108277666
   04131 Membrane trafficking [BR:ipu04131]
    108277666
   03051 Proteasome [BR:ipu03051]
    108277666
   03029 Mitochondrial biogenesis [BR:ipu03029]
    108277666
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ipu04147]
    108277666
Protein phosphatases and associated proteins [BR:ipu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     108277666
Spliceosome [BR:ipu03041]
 Complex B
  Other components
   Prp19 complex
    108277666
 Complex C
   Prp19-CDC5 complex
    108277666
Ribosome biogenesis [BR:ipu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    108277666
Chaperones and folding catalysts [BR:ipu03110]
 Heat shock proteins
  HSP70 / DNAK
   108277666
Membrane trafficking [BR:ipu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    108277666
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    108277666
Proteasome [BR:ipu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    108277666
Mitochondrial biogenesis [BR:ipu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    108277666
Exosome [BR:ipu04147]
 Exosomal proteins
  Proteins found in most exosomes
   108277666
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR DUF1464 CRIC_ras_sig
Motif
Other DBs
NCBI-GeneID: 108277666
NCBI-ProteinID: XP_017345957
UniProt: A0A2D0STD6
Position
17
AA seq 650 aa AA seqDB search
MSKGPAVGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPNNTVFDAKRLIGRRFDDAVVQSDMKHWPFKVVNDGGKPKVEVEYKGEMKTFYPEEVS
SMVLTKMKEISEAYLGKTVTNAVITVPAYFNDSQRQATKDAGTISGLNILRIINEPTAAA
IAYGLDKKVGCERNVLIFDLGGGTFDVSILTIEDGIFEVKATAGDTHLGGEDFDNRMVNH
FVAEFKRKFKKDITGNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGADFYTSITRA
RFEELNADLFRGTLEPVEKALRDAKMDKSQIHDIVLVGGSTRIPKIQKLLQDLFNGRDLN
KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAERYRSEDDAQREKVTAKN
TLESLAFNMKSTVDDEKLKDKISAEDKKAIVDKCNEVIAWLDRNQTAEKDEYEHQQKELE
KVCNPIIAKLYQGAGGMPGGMPGGMPGGSGGFPPGAGNSSSSGPTIEEVD
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaggtccagcagtaggcattgacttgggtaccacctactcatgcgttggcatt
tttcagcatggcaaggtggagatcattgccaatgatcaaggaaacaggactacgcccagt
tatgttgcctttacagacactgagagactgattggagatgctgccaagaaccaggtggcc
atgaaccctaacaacactgtgtttgatgccaagcgcttgattggtcggcgatttgacgat
gctgtggtgcagtcagacatgaagcactggccttttaaggtggtgaacgatggaggcaaa
cccaaagtggaggtggaatacaagggagagatgaagaccttttatcctgaagaggtgtcc
tctatggtcctcactaagatgaaggagatttctgaggcttatttgggcaaaactgtaaca
aatgctgttatcacagtacctgcctacttcaatgactcccagaggcaagccacaaaagat
gctggcaccatttctggcctgaatatcctccgcatcatcaatgagccaacagcagcagcc
attgcctatgggctggacaaaaaggttggttgtgaacgtaatgtcctcatttttgacctg
ggtggtggcaccttcgatgtatccatcctgaccattgaggatggcatctttgaggtcaag
gcgacagctggtgacactcatcttgggggtgaagattttgacaaccgtatggtcaatcac
ttcgtcgctgaatttaaacgtaaattcaagaaggatatcacaggaaataaacgtgcagtg
cggcgtttgagaacagcttgtgaacgtgccaagcgcacactgtcctccagcacacaggcc
agcattgagatcgactcgctttatgagggtgcagacttctacacctccattacaagggcg
cgcttcgaggagctcaatgctgacctgttccgtggtactctagagcctgttgaaaaggcc
ttgcgtgatgccaagatggacaagagccagattcatgacattgtccttgttggagggtcc
actcgcattcccaagatccaaaaactactgcaagacttgttcaatggtcgtgatctcaat
aagagcattaaccctgatgaagcagtggcctatggagcagctgtccaggcagcaatcttg
tcaggtgataagtcagaaaatgtccaagatcttcttctgctggatgtcactcctttgtct
ctggggattgagacagctggaggtgtcatgactgtgctcattaagaggaatactaccatc
cctaccaaacaaacccagacctttacaacctactcagacaaccagcctggtgtgctgatc
caggtatatgaaggagaacgagccatgacaaaggacaacaacattctaggaaaatttgag
ctgaccggcattccccctgccccccgaggtgtgccacagattgaagtgacctttgatatt
gatgccaatggtattctcaacgtgtctgcagtggacaagagcactggcaaggagaacaag
ataactatcactaatgacaaaggccgtctgtccaaggaggacattgagcgaatggtacag
gaagctgaaagataccgttcggaggatgatgctcagagggaaaaggtcacagccaagaac
actcttgagtccctagcctttaatatgaagagcacagtggatgatgagaaactcaaagac
aagatcagtgctgaggacaagaaggcaattgtggacaagtgcaatgaggttattgcttgg
ctggacaggaatcagactgcagaaaaggatgagtatgagcaccagcagaaagagctcgag
aaagtgtgtaacccaataatcgccaagctttaccaaggtgccgggggtatgccagggggt
atgccaggtggaatgcctggtggctcaggtgggttccctccaggtgcaggtaatagttct
tcctccggccccaccattgaggaagttgactaa

DBGET integrated database retrieval system