KEGG   Ictalurus punctatus (channel catfish): 108278348
Entry
108278348         CDS       T04658                                 

Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1-like
  KO
K04462  ecotropic virus integration site 1 protein
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108278348
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ipu03000]
    108278348
Transcription factors [BR:ipu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    108278348
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-H2C2_5 zf-C2H2_jaz zf-C2H2_8 zf-BED zinc_ribbon_15 PyrI_C
Other DBs
NCBI-GeneID: 108278348
NCBI-ProteinID: XP_017347160
UniProt: A0A2D0SXV6
Position
17
AA seq 1061 aa
MKAEEFSFEAMAPDIHEERQFRCEDCEQLFPSGSELLEHQNHSCSNRPSSGFTLPEQAIP
SATDECKECERVFPDGQSLEAHSLSHSDEREYKCDQCPKAFNWKSNLIRHQMSHDSGKHY
ECENCSKQVFTDPSNLQRHIRSQHVGARAHACPDCGKTFATSSGLKQHKHIHSSVKPFMC
EVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHFAAAAG
GLFGPGMALPGTPGMDKSALGMGPGSAGLADYFGPNRHHGGLTFPAAPAAFPFSFPGLFP
SGLYHRPPLIPATTPIKSPPALEFQKSPPLSSPLPGMQESQDLLMSLRKHSINGEGTENG
PEHLIEGSATKARQGIKTSDNSESSDLDDVSTPSGSELESTSGSELDSDAESDRDRERNR
ENGKGPKRRSSSPTMGQSPAHGSSSNGSVGNINGTDVPPQRLFSPVSDERTAVSGAVNDS
IKAIASIAEKYFGSTGLAGLHNKKGDPLGYPAMFPLPFFPAFSPPVYPFHEREHLRPRGH
KAEPESPSQESKKPQGSTAESPFDLTTKRKEECLAQTFATSKLEVPRILSANQDQPLDLS
LGGRGRSTRLRSGESQKNHMIGEDRNETEPPKADSTIQHARPTPFFMDPIYRVEKRKATD
PFEALKEKYMRPTPGFLFHPQLRMPDQRTWMSAIENMAEKLEAFGPLKSDAGDIMRSVPS
VFDFRAPATTLPETLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSF
SISSNLQRHIRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNLSGTAMSSPQSELD
SSSAILDDKEDSYFNEIRNFISSSGQSAGSPPHSDEGLNSGHFEDDKAVTDPRSHDLDEE
EGEEPGVEEEEEAELCDADKPANKAASSNLGDDIANDINDELDYDGAPDALLDCKSSPQR
CVFDEDDEDDEHGRFPALDHIRHFATDDAELSDGDVTGFDSAHLSEAVKPQLYRKSKSQA
YAMMLSLADKDPLPPPSHAASVWHTLGRTAESNAIQSLSHV
NT seq 3186 nt   +upstreamnt  +downstreamnt
atgaaggctgaagagttttcatttgaggccatggctccagatatacacgaggagcgtcag
ttccgctgtgaggactgcgagcagcttttcccgtccggctcagagctgctggagcatcag
aaccactcgtgttccaaccggccctcgtccggcttcacgctgcccgagcaggccatcccg
agcgccaccgacgagtgtaaagaatgtgagagagtgtttccggacggtcagagtctggag
gcacactctctctcccactcagacgagagggagtacaagtgtgaccagtgcccgaaggcc
ttcaactggaagtccaacctgattcgccaccagatgtcacatgacagcggcaagcactac
gaatgtgaaaactgctccaagcaggtgtttacagacccaagcaacttgcagaggcacatc
cgctcgcagcacgtcggtgcacgggcgcacgcctgccccgactgcggcaaaaccttcgcc
acgtcgtccggcctcaagcagcacaaacacatccactcgtccgtcaagcccttcatgtgc
gaggtgtgccacaagtcctacacccagttctcaaacctgtgtaggcacaagcgcatgcat
gctgactgtcggactcagatcaagtgcaaagactgtggccagatgtttagcaccacctct
tccctcaacaaacaccgccgcttttgcgaaggcaaaaaccattttgctgctgccgcagga
gggctttttggccctggcatggctcttcctggcactcccggaatggacaagtctgctcta
ggaatggggccaggatccgctggtttggcagattattttggtccaaataggcaccatggt
ggactaacgtttccagcagctcctgcagcattccccttcagttttccaggactcttccca
tctggactgtaccaccgaccacccctcatccctgccacaactcccataaaaagcccacca
gccttggaattccagaagagtccaccattatcctcacctttgcctgggatgcaagagtcc
caggacctcctgatgagcctccgaaagcactcgatcaacggggaaggaacagaaaatggg
ccagagcatctgatagaaggctccgccactaaggcaagacagggcattaagacaagtgac
aattcagagagcagtgacttggatgacgttagcactccaagtggaagtgagctagagagt
acttccgggtcagaactggacagcgatgctgagagtgaccgggatcgagaaaggaatcgg
gaaaatgggaaaggaccaaagaggagatccagtagtcctaccatggggcaaagccccgcc
cacggcagctccagcaatggcagtgttggcaacataaacggaactgatgtgcctccacaa
cgacttttttctcccgtttcggatgagcgcaccgctgtttctggagctgtcaatgattcc
atcaaggccattgcttccattgcagagaaatactttggctccacaggactggcaggtctg
cacaataaaaaaggggacccactgggataccctgccatgtttcccctccccttcttccct
gctttctctccaccagtctaccccttccatgagagggagcatcttcgacctcgaggccac
aaagcagagccagagagcccatcgcaagaaagcaagaagccacaaggcagcactgctgaa
tctcccttcgacctcaccacaaagcgcaaagaggagtgcctagcgcagacctttgccacc
tcgaagctggaggtaccccgtatactctctgccaatcaggaccaaccactggacctgagt
ttgggtgggcggggccggagcacacgccttagatcaggggagtcacagaagaaccacatg
attggtgaagacagaaatgagacagagcctccaaaagcagactccaccatccagcatgca
agacccaccccattctttatggaccccatttacagggttgagaagagaaaagcgacggat
ccgttcgaggcgctgaaagaaaagtatatgcgtcccacaccaggcttcctcttccaccca
cagctccgcatgcctgatcagaggacctggatgtcagcgatagaaaacatggcggagaag
ttggaagcgttcggcccgttgaagtccgacgccggcgacatcatgcgctcggttccctcc
gtgttcgatttccgagctccggccacgacgctgcccgaaacactgctgcgtaaggggaag
gaacgctacacatgcagatactgcggcaaaatattcccacgctcagctaacctcacacgc
catctccgaacacacacaggggagcaaccgtacaggtgtaagtattgcgatcgttcgttc
agtatctcgtcaaatctgcagcgtcacatcaggaacatccacaacaaagagaaaccgttc
aaatgccacctgtgtgaccgctgctttggccaacagaccaacctggaccggcacctcaaa
aaacacgagaacggtaatctgtcaggcacggcgatgtcctcaccacagtcagagctggac
agcagcagtgctatcctggatgataaagaggactcgtacttcaacgagattcgcaatttc
atcagcagcagtggccagagcgctggctcacctccacactccgatgaaggtttaaacagc
ggccatttcgaggacgacaaagccgtcaccgatccacggtcacatgacctggatgaagag
gaaggggaggagcctggagtggaggaggaagaggaagcagagctctgcgacgccgacaaa
cctgccaacaaagcagcgtctagcaacctaggtgacgacatcgccaacgacatcaacgac
gagctggactacgatggcgcccccgatgcactcctggactgcaaatcttctccacagagg
tgtgtgtttgacgaggatgacgaggacgacgagcacggccgattcccagcgctcgatcac
atccgtcacttcgccacggacgacgcggagctcagtgacggcgatgtcacaggatttgac
tccgcccacctgagcgaggctgtgaagccgcaactgtacaggaagtccaagtcacaggct
tacgccatgatgttgtctctggcagataaagaccctctgccccctccctctcacgccgcc
tcggtgtggcacacactcggacgcacggccgagtccaacgccatccagtccctcagtcac
gtatga

DBGET integrated database retrieval system