KEGG   Ictalurus punctatus (channel catfish): 108279081
Entry
108279081         CDS       T04658                                 

Gene name
dck
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00230  Purine metabolism
ipu00240  Pyrimidine metabolism
ipu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108279081 (dck)
   00240 Pyrimidine metabolism
    108279081 (dck)
Enzymes [BR:ipu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     108279081 (dck)
SSDB
Motif
Pfam: dNK AAA_33 AAA_18 AAA_28 Thymidylate_kin AAA_17
Other DBs
NCBI-GeneID: 108279081
NCBI-ProteinID: XP_017348535
UniProt: A0A2D0T1Q9
Position
18
AA seq 263 aa
MSRTPKRACSSALNDSLEKRLKRVSVEGNIAAGKSTFVRLLEQHDKEWEVVPEPIARWCN
VQTQHGEFEELTTSQKSGGNVLQMMYEKPERWAYTFQSYACMSRVRAQINSASGNLHHAE
NPVQFFERSVYSDRYIFAANLYESECLNETEWAIYQDWHGWLHKHFGQHIELDGIIYLRA
KPEKCLERLHVRGREEEQGIPLEYLEKLHYKHECWLQHRTLSMDFDYLCEVPVLTLDVND
DFKGDKFKCADMIEKVKDFLSTL
NT seq 792 nt   +upstreamnt  +downstreamnt
atgtctcgtactccaaaaagagcttgttccagtgctctgaacgacagtctggagaagaga
ttaaagcgggtttctgttgagggaaacatcgcggcggggaagtccacgtttgtccgcctg
ctggagcagcatgataaagagtgggaggtagtacccgagcccatcgctaggtggtgcaat
gtccaaactcaacatggagaatttgaggagctgaccacatcccaaaagagtggggggaac
gtattgcagatgatgtatgagaaaccggaacgctgggcgtacacattccagagttatgcg
tgcatgagccgtgtgcgcgcccaaatcaactccgccagcggcaacctgcaccacgccgag
aacccagtgcagttcttcgagagatctgtctacagtgacaggtacatctttgcagccaat
ctgtatgagagtgagtgtttaaatgagacggagtgggccatttatcaggactggcacggt
tggctgcataaacatttcggccagcacatcgagctggatggcatcatttacctgcgggcc
aaaccagagaagtgtttggagaggttgcatgtgagaggcagagaggaggagcaagggatt
ccgctggagtatctggagaaactccattacaagcacgagtgctggctacagcacaggacc
ctgagtatggactttgactatctttgtgaggttcccgttctcaccctggatgtcaacgat
gactttaaaggcgataaattcaaatgtgctgacatgattgaaaaggtgaaagactttctc
agcactctatga

DBGET integrated database retrieval system