KEGG   Ictalurus punctatus (channel catfish): 108279306Help
Entry
108279306         CDS       T04658                                 

Definition
(RefSeq) glutamate receptor 1-like
  KO
K05197  glutamate receptor 1
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108279306
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ipu04040]
    108279306
Ion channels [BR:ipu04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   108279306
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lig_chan ANF_receptor Lig_chan-Glu_bd SBP_bac_3 DUF2061
Motif
Other DBs
NCBI-GeneID: 108279306
NCBI-ProteinID: XP_017348936
UniProt: A0A2D0T2A9
Position
18
AA seq 921 aa AA seqDB search
MEPSLALLLTSLLGWCSCSSFPSNINIGGLFPTDSHEYEVFRFALSQQHELPKLVPQVDM
VDVGSSFAMTYAFCSQFSKGVYAIIGLYDKKTMNMLMSFCGALHVCFVTPSFPIETNNQF
VIQLRPQLQDALIGLVEHYKWTKFVYMYSSDSGLTVLQKILDTAAEKSWQVTSINFDTLT
EAAFINSIQDLDSKKEHKIILDCELERLNSILNLIAAQKKNLKNYHFILANLGFLDLNLT
EFRKGGANITGFQLMNYTDPMVSRTIDDWLDFDSKDLKSPKRRLKYTGALTYDGVSVMAT
AFQNLRRQRIDISRRGNAGECLANPPAPWGQGIDIQRALQQVQFEGLTGHVQFNEKGHRT
NFTVSVLELVPSGPKKVGYWNENEKYVSTATYAHTLNETFGMHNRTYIVTTILESPYVML
KKNHEQLSGNDRYEGYCVELAAEIAKHVGYSYKLELVPDGKYGARDPDTKMWNGMVGELV
YGKADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPTKSKPGVFSFLDPLAYEIWMC
IVFAYIGVSVVLFLVSRFSPYEWHSDDSEDSGEHLSQNRTPSPEAGQSQLQDQHGQSPSQ
QDKQEKPPEHSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYT
ANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDGGSTKEFFMRSKIAVFEKMWSYMKFA
DPSVFVKTTDDGVVRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATP
KGSDLRNRVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFY
ILIGGLGLAMLVALVEFCYKSRIQSRRMKQIIDAAMLGSSLSRMGSGGENGRVVAHDFPK
AAQTLPCMGQAAGMGMNTSGM
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atggagccaagcctggccttactgctcaccagcttgctcggctggtgctcgtgctcgagt
ttcccaagtaacattaatataggcggtttgttcccgaccgactcgcatgaatatgaggtg
ttccgattcgcgctatctcagcagcacgagctccccaaactggtgccacaagtggacatg
gtggacgtgggcagcagttttgccatgacatacgcattttgttcccagttctctaaagga
gtctacgccataatcggtctatatgacaagaagaccatgaacatgttgatgtcgttctgt
ggggctctgcatgtctgcttcgtcacacccagcttcccaatcgagaccaacaatcagttt
gtaatccaactcaggccgcagctccaggatgctctgattggccttgtggaacactacaag
tggaccaaatttgtctacatgtatagctcagattcaggactgactgtgctacagaaaatc
ctggacacagctgcagaaaagagttggcaggtgacatccatcaactttgatactcttaca
gaggcagccttcattaactctatccaggacctggacagcaaaaaagagcacaagatcatt
ctggactgcgagctggaaagacttaactccattcttaacctgattgcagcgcaaaaaaag
aatctgaagaattatcactttatcctggcaaacctgggctttctggacctgaatttgaca
gagttcaggaaaggtggtgccaacatcacaggcttccagttaatgaactacacagacccc
atggttagcaggactatagatgactggctggactttgacagcaaagacctgaagagccct
aagaggagactcaagtacacaggagcgctcacctatgatggtgtgagtgtcatggccact
gctttccaaaacctcaggaggcagcgtatcgacatttcccggcgagggaatgcaggcgaa
tgtctggccaaccccccagcaccatggggccaaggcattgacatccagagagccctccaa
caggtacagtttgaaggtctaacaggccacgtccagttcaacgagaaaggacatcgaaca
aactttactgtcagcgtactggagcttgttccgagtggacccaagaaggtgggctactgg
aacgaaaatgagaagtatgtgagcacggcgacgtacgcccacacactcaacgagacattc
ggcatgcacaataggacatacattgtcaccaccattctagaatctccgtacgtgatgctg
aagaaaaatcacgagcagctgtcagggaacgataggtacgagggatactgcgtggaattg
gctgccgagatcgccaaacatgtgggctactcctacaagttggaactcgtgccagacggc
aagtacggagcccgagaccctgataccaaaatgtggaacgggatggttggagagctggtg
tatgggaaagccgatgtagccgtggctcctctcacgatcaccctggttcgagaggaggtc
atcgacttctccaagcccttcatgagcttgggcatctctatcatgatcaagaagcccacc
aaatccaagccaggcgtcttctccttcctggacccgctggcatacgagatctggatgtgt
atagtgtttgcgtacatcggtgtcagcgtggtcctattcctggtgagccgtttcagtccg
tacgagtggcacagtgacgactcagaggacagcggtgagcatctgagccagaaccggaca
ccgtccccggaagccggacaatcgcagttgcaggatcagcatggccagagtccaagccag
caagacaagcaggagaaaccacctgaacactccaacgagttcggcatttttaatagtctg
tggttctctctgggtgccttcatgcagcaaggctgcgatatttcacccagatcactctcg
ggtcgtatagttggaggcgtctggtggttcttcaccctcatcattatctcctcctacacg
gccaacctggctgccttcctgactgtggagaggatggtgtcacccatagagagtgcagaa
gacctggccaagcagacagagatcgcttacggcaccttggatggaggatcgaccaaagag
ttcttcatgaggtcaaagatagccgtgtttgagaagatgtggtcctacatgaagtttgca
gatccgtcagtgtttgtaaaaaccactgatgatggagtggtgagagtgcggaagtccaaa
gggaaatacgcttatctgctggagtccaccatgaacgaatacatcgaacagcgcaaaccc
tgtgacaccatgaaggtgggcggaaacctggactccaaggggtatggggttgcaactcct
aaaggctctgacttaagaaaccgagtaaacctggcagtgttaaaactgaacgagcagggc
ctgttggacaaattgaaaaacaaatggtggtacgacaagggcgagtgcggcagcggggga
ggtgattccaaggataagaccagcgccctgagcctcagtaatgtggcaggggttttctac
atcctgattggaggactggggctggccatgctggtggccttggtcgagttttgttacaaa
tccagaatccagtctcggagaatgaagcaaatcatcgacgcagcaatgttgggctccagc
ctgagccgcatgggcagcggaggggagaacggccgtgtggtggctcacgattttcccaaa
gcagcacagactctgccctgcatgggccaagcagcgggcatgggcatgaacaccagcggt
atgtag

DBGET integrated database retrieval system