KEGG   Ictalurus punctatus (channel catfish): 108279671Help
Entry
108279671         CDS       T04658                                 

Gene name
PARP12
Definition
(RefSeq) poly [ADP-ribose] polymerase 12-like
  KO
K15259  poly [ADP-ribose] polymerase 7/11/12/13 [EC:2.4.2.30]
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    108279671 (PARP12)
Enzymes [BR:ipu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     108279671 (PARP12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP WWE Torus zf-CCCH_4 zf_CCCH_4 ART-PolyVal zf-CCCH DUF3024
Motif
Other DBs
NCBI-GeneID: 108279671
NCBI-ProteinID: XP_017349494
UniProt: W5U6P7
Position
19
AA seq 1141 aa AA seqDB search
MAEETIVIKVICDHLGCVEYDELLQMAEVEDLENVIKNSDVFTVIQPRNHQNKSKKILVT
TNIRRCRARECQESCADLHLCKFYLVGQCNAQRCKYGHSLETEHNSRVLRKHSLHDLSKD
QLRVLLLLNDSSLLPNVCVSYNKGSGEFGNCPDKEACDRLHVCEKYIRGLCDGSVECNRC
HDFFEPHPTKAFQAKGVASHLIKSLLLIYRSILTLKDHRYARDKPAVRSKENPQSSNRAG
VYQSLQSNAVNEICLSFIRGSCKYGDKCWRVHFGVPYKWEVEVDEVWMDLPDNEVIERDY
CDPAKIHSVGSEPVCFDTMMHGLHRVRRLSTVSSVIEPSFSHTTKWVWYWENEYNKWIPY
GSIKEMHRLSCINSEALEKKYLQFLENNSHDVLKFSAGKQFYELNFRDMKQRNEMSHTER
TVRRRPSFVSLFDVRTARTRRGPNTYTHTGVPGFWDKTAIPESGFQRVLLDASHKDYVRV
QEHFKKTMKDFSILRIERVQNKELWVDFQTKRERMKKANSHKKYAEGERLLFHGTNANSV
DAICLQNFDMRVSGANGTVYGQGSYFARDAKYSNDYADRYGERSMFACRVLVGQYTKGAS
HYRRPPAKDTAGNLYDSCVNDVREPTIYVVFDRPQVYPEFLITYEKTRFPEEISIIPSNC
TANVSTCNSVFDDVSQTASGIISSPHKVNNITFGSTCTGETLAAASIPITGNSFFSALGS
PVKPEKDVSLDTQTDDTNSLNVAQKSGLCVRSKTTQGLTSLSRLLKESDRALCTSVKIPV
FSGSDRLLIAVEPSLTDNSIQSGIAKNPQESSTVCASDLSTERMSQRSRQDSQNAARLRS
LEFAKAMTDTMDPFSPSSDKARIPDASSTSSVSISEMESKSSMPYNTSCSSALNKSPSDG
SLSGSLASFYETRSCENTSQRFNAVDDVFNVSQPAGVISTSSPREAYITSASTSTGEEFL
TSKPAQGSTSLSYTGLSRKSGQDLLASVKIPVSSHSDNQLLISGKSSVTDKSIHCKLSPN
PDLVTTQNSQSSQQVSQTPAARSTIPSSTATLRNLSSDASSASSHSEKESKISVKYQTSS
FSADKQSHSDGSLSSSSVSFYEMQPVAFSSKPTPPKAPKEAEQQQKNILQAQRARKPCVV
Q
NT seq 3426 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggaaaccatcgttattaaagtcatctgcgatcacctcggatgtgtggagtac
gatgagcttctgcagatggcagaagtggaagatttggaaaatgttatcaagaacagcgac
gttttcactgttatacaaccaagaaaccatcaaaacaagagcaaaaaaatcctagtcact
actaatatcaggcgctgcagagcaagagagtgtcaggagagctgtgctgatctgcatctt
tgtaaattttaccttgtgggacaatgcaacgcacaaaggtgtaaatacggccacagtctg
gagacggagcacaattccagagttctacgtaagcacagcttacatgatttgagcaaagat
caactgcgtgtgctgttgctactgaacgacagctccctgttgcccaacgtctgtgtctca
tacaacaaaggcagtggtgagtttgggaactgtccggataaggaggcctgtgatcggctc
cacgtctgtgagaagtacatcagaggactgtgtgacggcagcgttgagtgcaacagatgt
catgatttcttcgagcctcatccaacaaaagcattccaggccaaaggagtagccagtcat
ctgataaaatctcttttgctgatctatcgcagtattctgacactaaaggaccacaggtat
gctcgggataaacctgctgtcagaagcaaggagaaccctcaatccagcaacagagccggt
gtataccagtccttacagagcaacgcagtgaatgagatttgcctgtcgtttatcagagga
agctgcaaatatggagataaatgctggagagtccattttggcgttccctataagtgggag
gtggaggtagatgaggtttggatggacttacctgacaatgaagtgatagaaagagactac
tgcgatccagccaagatccacagtgtgggcagtgagcctgtgtgttttgacacaatgatg
cacgggcttcacagggtgcggcgtctctctacagtgtcttcagtgattgaacccagcttc
agccacactacaaagtgggtctggtactgggagaatgaatataataagtggatcccgtat
ggatcaattaaggagatgcataggctgtcctgcatcaacagtgaggctctagagaaaaaa
tacctccagttcctggagaacaacagccacgacgtgttgaaattttctgctggtaaacag
ttttatgagctgaatttcagagatatgaagcagaggaacgaaatgagtcacacagagcga
acagttagacgccggccgtcgtttgtttctctcttcgacgtccggactgctagaaccaga
agaggtccaaacacctacactcatacaggtgtcccaggtttttgggataaaactgcaatt
cctgaatctggatttcagcgagtcttacttgacgcgtctcacaaggactacgtcagggta
caggaacatttcaaaaagactatgaaggactttagcatcctgcgcatcgaacgagtccag
aacaaggaattgtgggtggattttcagacgaaaagagagcgaatgaaaaaagcaaacagc
cacaagaaatacgccgagggagagcgattgttgttccatggcaccaacgccaacagtgtt
gacgctatatgtctccagaacttcgacatgagggtatctggagccaatggaacagtgtac
gggcaaggaagttactttgccagggatgcaaagtattccaatgattacgcagatcgttac
ggtgaaagatccatgttcgcatgcagagtgttggttggacagtacacgaaaggagcatcc
cattaccgcaggcctccagccaaagatacagcaggaaatctttatgacagttgtgtaaat
gacgtacgcgagcccaccatttatgtagtgtttgaccggccccaggtttacccggaattt
ctgataacatatgagaagaccaggtttcctgaagagatcagcattattccgtctaattgc
acagcaaatgtcagcacgtgtaattctgttttcgatgatgtgagccaaacagcgagtggg
attatcagctcacctcacaaggtaaacaatatcaccttcggttcaacttgtacaggagag
acattagccgccgcgagcattcccataacgggaaactcttttttttctgctttgggttcg
ccagtgaaaccagagaaagatgtctctttggacactcagacagatgatacaaatagccta
aatgtagctcagaaaagtgggctgtgtgttcgttcaaagacgactcagggtttaacttca
ctcagcaggttgctaaaagagtcagatcgggccttatgtacatctgttaaaattccagtt
ttctccggttcagatcgtcttctaatcgctgttgaacctagcttaacagataacagtatt
caatctgggatcgccaaaaacccacaagagtcttcgacagtttgcgcctctgacttatcc
actgaaagaatgtctcagagatcacggcaagattcacaaaatgctgcacgtctcagaagc
ctagagttcgctaaagcaatgactgacactatggatccattttcaccttcttcagacaag
gccaggatccctgatgcttcttcaacctcctccgtctccatctcagagatggagagcaaa
agctcaatgccatacaacaccagttgctcttcagctcttaataagtctccctctgatggt
tccttgtcaggatccttagcttccttttatgaaactcgctcttgtgaaaataccagccaa
aggtttaatgccgttgatgatgtatttaacgtgagccaaccagcaggtgtgattagcaca
agttcacctcgagaggcatacatcacttctgcctcaactagtacaggagaggaattcctc
acttcaaagccagctcagggttcaacatcgctgagctacactggcttgtcaagaaagtca
ggccaggatttgcttgcatctgtgaaaatcccagtttcctcccattcagataatcagctg
ctgatctcgggtaagtctagcgtaacggataaaagtatacactgtaagcttagcccaaac
ccagacttggtcactacacaaaactctcagagctcacagcaagtttcacaaacacctgca
gcccgtagcactataccaagttctacagccacgcttcgaaacctaagctctgatgcctct
tctgccagcagtcattcagaaaaggaaagcaaaatatcagtgaagtaccaaaccagttcc
ttttcagctgataagcagtctcactctgatggctccttgtcaagttcttcagtttccttt
tatgaaatgcagcctgttgctttttccagcaaaccaactcctccgaaagcccctaaagaa
gcagaacagcagcagaagaacatcttacaagctcaacgtgcgcggaaaccttgtgtggtg
cagtga

DBGET integrated database retrieval system