KEGG   Ictalurus punctatus (channel catfish): 108280477Help
Entry
108280477         CDS       T04658                                 

Gene name
tyw3
Definition
(RefSeq) tRNA-yW synthesizing protein 3 homolog
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ipu03016]
    108280477 (tyw3)
Enzymes [BR:ipu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     108280477 (tyw3)
Transfer RNA biogenesis [BR:ipu03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    108280477 (tyw3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TYW3
Motif
Other DBs
NCBI-GeneID: 108280477
NCBI-ProteinID: XP_017350961
UniProt: A0A2D0T7Y2
Position
20
AA seq 276 aa AA seqDB search
MQKVNESNYYYKRSLVKCTAMEGENAFKLWKKQCLNKMDLSKKGSVDEDINTVVSFLNNS
DNYFTTSSCSGRIILIDGVSDCVDVQKQNCSWLFVTHNKCTKDHVMAGLEESSGDAVFKF
EPCVLHVQCRRLEDAQLLHSVAINSGFRNSGVTVGKKGKIIMAVRSTHCLEVPLSHKGKV
LVSEDYITFLVGVANSKMDENLKRIERFYDCLRSSLEPEEDKRCVKDAEADENAVYRRRR
RRRRRERDVAGSDCSVRQQSDSEHDDELNGQLTLFS
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaagtgaatgagtcgaattattattataagcgttcattagtcaagtgtaccgct
atggaaggagaaaacgcgtttaaactgtggaagaagcagtgtctaaacaagatggacttg
agtaaaaagggcagtgtagatgaggacattaacactgtggtctcctttctaaataattcg
gacaactatttcaccacaagttcgtgttctggaagaatcatcctgattgacggggtgtct
gactgtgttgatgtgcagaagcagaattgttcctggctctttgtcactcataacaagtgt
acaaaagatcacgtgatggccggtttggaggaatcttctggagacgctgtttttaagttt
gaaccttgtgttcttcatgtgcaatgcagacggctagaggacgcacagctcctgcactcc
gtcgccataaactcagggttcaggaactctggagtgaccgtgggaaagaaaggcaaaatc
attatggccgtgcgcagtacccactgtctcgaagttcctctcagccacaaggggaaagtc
ctggtttctgaagactacatcacttttcttgtcggagttgcgaatagtaaaatggacgaa
aacctcaagaggatcgaaaggttttacgactgtctgagatcttcgctggaaccagaggag
gataaaaggtgtgtaaaggacgcagaggcagatgagaacgctgtgtacagacggaggagg
aggaggaggaggagggagcgggacgtcgcgggatcagactgtagcgtcagacagcagagt
gacagtgagcacgatgacgagctgaacggccaactgacgttattctcttag

DBGET integrated database retrieval system