KEGG   Ictalurus punctatus (channel catfish): 108280895
Entry
108280895         CDS       T04658                                 

Definition
(RefSeq) uncharacterized LOC108280895
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ipu03000]
    108280895
Transcription factors [BR:ipu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    108280895
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 108280895
NCBI-ProteinID: XP_017351884
UniProt: A0A2D0TAI6
Position
20
AA seq 625 aa
MYLRVFQLEFVCSVYSDWPNIMIPPGECLYAGRKRRKPMQKQKPAGVNQKSNPSKRHRDR
LNAELDRLASLLPFNPEVISKLDKLSVLRLSVSYLRVKSFFQTIQEKSSKKQSPASCSPE
PKKHSLGNSILESDLLLESLTGFALIVSSDGVIFYASSTIVEYLGFHQTDVMHQNVFDYI
HVDERQEFRRQLHWAMNPQQEHHSPSGNDEDYMVRSLFNAQELNGVPPELSPFLTRCFIA
RVRCLLDNKSGFLRMQFQGSLKFLQGQKRKSKSGALMPPQLALFCVAVPLVLPSITELKM
KGMMSKPKGSNISEKRHHISRTSCDADDMNLNWHSGSWTALTKEGTQYKSEGLYVQDEPL
NFCMSSTAAHKVQPTQSPWDSRCHSASQGGYFSSKLGKHVQSGKFRFSPGCAAAAMSQCK
QYGLGDKDGYCGYRKTESTRYTGNNDCYSNLLLPETAIKTEHDSDSENGCSIYGTPHNGA
WRYSTPFPDAHQVKTEADYDEYYSKPSITNISSINGHHKYLYTGAGRPLKCVLNKDHSDP
HSLQDTNCHAYTNSSESKVFMQPDYKLSYEVRNHSLLHPIKREPVDSLPWTEGSHDVIQQ
HVDRNEANCALNTVVHKTSAYLYMQ
NT seq 1878 nt   +upstreamnt  +downstreamnt
atgtacttgagagtttttcagttagaatttgtttgtagtgtttatagcgactggccaaac
atcatgattccacctggagagtgtctgtatgctgggaggaagaggagaaagcccatgcaa
aagcaaaaaccagcaggggtgaaccagaagtcgaacccgtctaaaagacaccgggaccgt
ctcaatgccgagttggaccgactggccagcctgttgccattcaatccagaggtcatctcc
aaattggacaaactgtcggtgctgcgtctcagcgtgagctatctccgcgtcaagagcttc
tttcaaacaattcaggagaaatcaagcaaaaagcaaagccctgcctcctgcagccctgag
cccaagaaacacagtctaggcaacagtattctggaaagtgatcttcttcttgagtctttg
acagggtttgcactgatcgttagctcagatggtgtcatcttctatgcttcttctacaatc
gtagaatacctgggcttccatcagaccgatgtgatgcaccagaatgtcttcgattacatc
catgtggacgagcggcaggagttcagaagacagctgcattgggccatgaatccccagcag
gaacaccactctccctcaggaaatgatgaagactacatggtaagaagtctgtttaacgct
caagagctaaacggcgtccctccggaactttctccattcctcactcgctgcttcatcgct
cgagtacgctgcctgctcgacaacaaatccggcttcctgaggatgcagtttcagggcagt
ctgaagttcctccaaggccagaagaggaagagtaaatccggagctttgatgccgcctcag
ctggctctgttctgtgtggccgtgccgcttgtcctgccctccatcaccgagctgaagatg
aagggcatgatgagcaaaccgaaaggctccaacatcagtgaaaagaggcaccacatttct
cgcacctcttgtgacgctgacgacatgaatcttaactggcacagcggatcgtggacggct
cttaccaaagagggcacccaatataaaagtgaaggtctgtacgtccaggacgagcccctt
aacttctgcatgtcctctacggcggcccataaagtgcagcctacgcaaagtccctgggac
tctcggtgtcactctgcctcacagggcggatacttcagcagcaaattggggaagcacgtc
cagtccggaaaattccgcttctccccaggttgcgctgctgcggcgatgtcccagtgtaag
cagtatggactcggtgataaggacgggtactgtggctacaggaagactgagagtactaga
tacacgggcaataatgattgttacagcaacctcctgctgcccgagaccgccataaagacg
gagcatgattccgactcggagaacggatgcagcatatacggcacgccccataacggcgcc
tggcgctacagcacacccttcccagacgcacaccaggtgaaaacagaggcagactatgat
gagtattatagcaaacctagcatcacaaatatctccagcatcaacggacaccacaaatat
ctctacacaggagcgggaaggccgctgaaatgcgtccttaataaagaccattcagatcct
cacagcctccaggatacaaactgccacgcatacacgaacagctctgagtccaaggtcttt
atgcagcccgactacaagctcagctacgaggtgaggaaccacagtcttcttcaccccatc
aaaagagaacccgttgactctctgccctggactgaaggcagccatgatgttattcaacaa
cacgtggacagaaatgaggcaaattgtgcactgaacacagtggtgcacaaaaccagcgcc
tatttgtatatgcaataa

DBGET integrated database retrieval system