KEGG   Ictalurus punctatus (channel catfish): 108281000
Entry
108281000         CDS       T04658                                 

Gene name
rdh5
Definition
(RefSeq) retinol dehydrogenase 5
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:ipu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    108281000 (rdh5)
Enzymes [BR:ipu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     108281000 (rdh5)
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR
Other DBs
NCBI-GeneID: 108281000
NCBI-ProteinID: XP_017352012
UniProt: A0A2D0TAX2
Position
21
AA seq 334 aa
MDMELLYEYIGKDHLVSYTVGAFVLLWALIWLYRDSLEIDKIKEKYVFVTGCDSGFGNLL
CKQLDKRGFRVLAGCLTDKGADDLKRVTGSYLKTCILDVTSTVSIQNAVEWTKKEVGDRG
LWGIVNNAGRALPMGPSEWMQIEDFQGTLRVNMTGVIETTINFLPLVKKARGRIVNVASV
LGRVAANGGGYCISKFAVESFSDCLRRDIQHFGIKVCIIEPGFFKTQVTSLEPLERELHR
LWNQLTPDVKESYGEKYLDKYINVQRLIMNTICDADLSKVTNCMEHALSAAHPRTRYSAG
WDAKLLWIPLSYMPACVVDIALRLVLPRPVKSVL
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggacatggagcttctatacgaatatatcggtaaggatcacctggtctcgtacactgtt
ggtgcctttgtgctgttgtgggctttgatatggctgtaccgtgacagtctagaaatcgac
aaaatcaaagagaagtacgtgttcgtcaccggctgtgattcaggttttgggaacctgcta
tgtaaacaactggacaaacgtggtttccgtgtgttggccgggtgcttgacagacaaagga
gcagatgatctgaagagagtgacgggatcttacctgaagacctgcatactggatgttact
agcacagttagcattcagaacgctgtggaatggacaaaaaaggaggttggagacagagga
ttgtgggggatcgtgaacaatgcaggacgcgcattacccatgggtccttctgagtggatg
cagattgaggatttccagggcactctaagggtcaacatgaccggtgtgatcgagacgacc
ataaatttcctgccacttgtcaagaaagcccgtgggcgaattgttaatgtggcgtcagtg
ctgggaagagtggcagcaaacggaggtggatactgcatttccaagtttgcagtggaatcc
ttttcggattgcctcaggagggacattcaacattttggaatcaaagtgtgtataatagaa
ccagggttcttcaagacccaggtgacaagcctggaaccactcgaacgggaacttcatcgc
ctgtggaaccagctgacgcctgacgtgaaagagagttacggagagaaatatctggataag
tacattaatgtacagaggttgattatgaatactatttgtgatgctgatttgagtaaagtg
accaactgcatggagcacgctctgtctgctgctcatccaaggacccgatacagtgctgga
tgggacgccaaactcctctggatccctctctcttacatgccagcttgtgttgttgacatt
gcactaagactggtgttgcctcggcctgttaaaagtgttttatag

DBGET integrated database retrieval system