KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW000095Help
Entry
IscW_ISCW000095   CDS       T01131                                 

Definition
(GenBank) ribosomal protein L22, putative
  KO
K02890  large subunit ribosomal protein L22
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc03010  Ribosome
Brite
KEGG Orthology (KO) [BR:isc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    IscW_ISCW000095
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:isc03011]
    IscW_ISCW000095
Ribosome [BR:isc03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    IscW_ISCW000095
  Bacteria
    IscW_ISCW000095
  Archaea
    IscW_ISCW000095
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22 RRP14
Motif
Other DBs
NCBI-ProteinID: EEC01253
VectorBase: ISCW000095
UniProt: B7P3T1
AA seq 213 aa AA seqDB search
MFAFCRQALRSVVASPSTPSLASQFLKSGISTTPAALCLFNRNMPVPRKWPLQNKKIYPP
QEPEEERRPAWVCHYRNQIRYSPKKMLALTQFIRGMSIDEAIKQLSFVQKKGAKIMLEVL
KEAQEMAVKHHNVEFKSNLWVAESFTGKGVCIKGLRRHARGRMGMIRYQYSHFFVRLVEG
APPKHYYGAPKTAEQKLEEYVQTLRDRRITHGI
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgttcgccttctgccggcaagccctgcgcagtgtcgtcgcatcgccctctacgccgtcc
ctcgctagccagttcctcaaaagcggcatcagcacgacgcccgccgcactctgcctcttc
aaccggaacatgcccgtgccgcggaaatggccgctccagaacaagaagatctaccctccg
caggaaccggaggaagagcggcgtcccgcctgggtgtgccactaccgcaaccagatacgc
tactctcccaagaagatgctggctctcacccagttcatccgtggcatgagcatagacgag
gccatcaagcagctctcgtttgtccagaagaaaggggccaaaatcatgctcgaggtcctc
aaagaggcccaggagatggcggtgaagcaccacaacgtggagttcaagtctaacctctgg
gtggccgagtcgttcacagggaagggggtctgcatcaaggggttgaggaggcacgcgcgg
gggagaatggggatgatccgctaccagtactcgcacttctttgtgaggctcgtggagggc
gcccctccgaagcactactacggtgcgcccaagacagcagagcagaagctggaggagtat
gtgcagacgttgagggatcggaggattacgcacggaatctga

DBGET integrated database retrieval system