KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW000465Help
Entry
IscW_ISCW000465   CDS       T01131                                 

Definition
(GenBank) signal recognition particle receptor, putative
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
KEGG Orthology (KO) [BR:isc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:isc04131]
    IscW_ISCW000465
Membrane trafficking [BR:isc04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    IscW_ISCW000465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2
Motif
Other DBs
NCBI-ProteinID: EEC02253
VectorBase: ISCW000465
UniProt: B7P6N1
AA seq 341 aa AA seqDB search
MYEATNEVYKILIPISESHRDYKKLANIHSKLHEAFTKVVQQAGKRVFGTYFRVGFYGPR
FGDLDGEEFIYKEPTLTKLPEISHRLESFYSERFGSDYVEVIKDSNMVDVSRLHPEKAYI
QITYVEPYFDMYELRERHTYFDKNYNIKRFVYATPFTPDGRAHGDLHEQYKRKTIVTVAN
SFPYVKTRIQVVERKQVVLTPIEVAIEDIQKKTLELALATQQEPSDPKILQMVLQGSMGP
TVNQGPMEVALVFLSDLQDPLRAPSPWQHKLRLCFKDFSRKCNDALRKNKTLIGADQRDY
QKELERNYHRFSERLLPMIRNNSFLYRSAVPADGRPAKVAL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaggccactaacgaggtctacaagatcctgatccccatatcggagtcccatcgg
gactacaaaaagttggccaacatccacagcaaactgcacgaggccttcacaaaggtagtg
cagcaggccggcaaacgtgtgtttggaacctacttccgggtgggattctacggaccacgg
ttcggcgacctggacggtgaagagttcatctacaaggagccgaccctgaccaagctgccc
gagatctcccatcgcctcgagagcttttactcggagcgatttggctcggactacgtggaa
gtgatcaaggactcgaacatggtggacgtgtcccggcttcatcctgaaaaggcttacatc
cagatcacttacgtggagccgtactttgacatgtacgagctacgggagaggcacacatac
ttcgacaagaactacaacatcaagcggtttgtgtacgccacgcccttcacgccggacggc
cgggcccatggcgacctgcacgagcagtacaagcgcaagaccatcgtgacggtggccaac
tccttcccctatgtcaagacgcggatccaggtcgtggagcgcaagcaggtggtgctgacg
ccgatcgaggtagccatcgaggacatccagaagaagactttggagctggccctggcaacg
cagcaggaaccctcggaccccaaaatcctgcagatggtgctgcaggggtccatgggcccc
accgtcaaccagggccccatggaggtggcactggtgttcctctcggacctgcaggacccg
ctccgggcaccctcgccctggcagcacaagctgcgcctctgcttcaaggacttcagccgc
aagtgcaacgacgccctacgcaagaacaagacgctgattggggccgaccagagggactac
cagaaggagcttgagcgcaactaccaccgcttctccgagcgcctgctgcccatgatacgg
aacaattccttcctctaccgctcggcagttcctgcagacggaagaccggcaaaggttgcg
ctgtga

DBGET integrated database retrieval system