KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW002690Help
Entry
IscW_ISCW002690   CDS       T01131                                 

Definition
(RefSeq) serine/threonine protein kinase, putative
  KO
K11481  aurora kinase A [EC:2.7.11.1]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     IscW_ISCW002690
Protein kinases [BR:isc01001]
 Serine/threonine kinases: AGC group
  AUR family [OT]
   IscW_ISCW002690
Protein phosphatases and associated proteins [BR:isc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     IscW_ISCW002690
Chromosome and associated proteins [BR:isc03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    IscW_ISCW002690
   Spindle formation proteins
    IscW_ISCW002690
  Sister chromatid separation proteins
   Aurora kinases
    IscW_ISCW002690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 8027700
NCBI-ProteinID: XP_002409277
VectorBase: ISCW002690
UniProt: B7PC35
AA seq 278 aa AA seqDB search
MSACRFTTEWTLQDFEVGKPLGKGKFGNVYLAREKNTKFIIALKVMFKSQLQKNNVEHQL
RREIEIQSHLSHPHVLKLYGWFHDATRIYLILEYAPNGELYKQLTKAKRFDDKRAATYIY
QMCVALKYCHANKVIHRDIKPENLLLGYNGELKIADFGWSVHAPSSRRVTMCGTLDYLPP
EMVENSVYDERVDLWALGVLTYEFLVGNPPFESKSTQATYGRIRAVDLHFPDHVCPPARD
LIGKLLKKVPKERASLDEVLAHPWVVDNADTTVEASTL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcttgcaggttcacaacggaatggacactgcaggattttgaagtaggcaagcca
ctgggcaaggggaagttcggaaatgtttacctggcacgcgagaaaaacaccaagttcatc
atcgccctcaaggtgatgtttaaatctcagcttcaaaaaaataatgttgagcatcagctt
cgccgggaaattgaaatccagtcgcatctcagccaccctcacgtcctgaaactgtacggg
tggttccacgacgccacccggatctacctgatcctggagtatgcacccaacggcgagctc
tacaagcagctcacaaaggccaagaggttcgacgacaagagggccgccacctacatctac
cagatgtgtgtggccctcaagtattgtcacgccaacaaggtgatccaccgggacatcaag
cccgagaacctgcttctcggctacaacggggagctcaagattgcggacttcggctggtcc
gtgcacgcgccctcatccaggcgggtgaccatgtgcggcaccctggactacctgccgccc
gagatggtggagaacagcgtgtacgacgagcgggtggacctgtgggccctgggcgtgctc
acctacgagttcctggtgggcaacccgcccttcgagtccaagtctacccaggccacctac
ggtcgcatccgtgccgtggatcttcacttcccggatcacgtctgcccgccggctagggac
ctcatcggcaagctcctgaagaaagtcccgaaggaacgagcatcgttggacgaagtgctg
gcacacccgtgggtcgtggacaacgccgacacgacggtcgaagcgtcaactctttga

DBGET integrated database retrieval system