KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW003591Help
Entry
IscW_ISCW003591   CDS       T01131                                 

Definition
(RefSeq) secreted multiple inositol polyphosphate phosphatase, putative
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00010  Glycolysis / Gluconeogenesis
isc00562  Inositol phosphate metabolism
isc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:isc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IscW_ISCW003591
   00562 Inositol phosphate metabolism
    IscW_ISCW003591
Enzymes [BR:isc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     IscW_ISCW003591
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     IscW_ISCW003591
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 8028712
NCBI-ProteinID: XP_002401241
VectorBase: ISCW003591
UniProt: B7PGQ6
AA seq 386 aa AA seqDB search
GCRPRAFFLYNRHTTRYPDRENIVEMQDVLPQLLRNILSAAQEKKVHICETDLEQLERWK
MPFKPHHDNKVTPSGKSVVGDQVRRLRRRFPGLFQGQFNASDFVVGYTSRERTRQTAEAF
LEHLLSKQGERPEFLPSPGLGRFAHHEQSVDAFPAGLQEKKSTPVEVDKFEKGPYMKRLL
DTMSWRLGFNTSFVSRDADDVDIMYRACVFEYAIHDASPWCAAFDEAELKAIEFREDLDD
YYKDAYGLKRNYAQACPIVRELVGRFRNVSKDPSQPTKLLYFSHAGGFKKVVARLGLYRD
AEPPLADGLCRQSGRAWQSSLVCPFNANLAFVLFECTGGGHQVATFLNEEVQRLPGCPSE
SCPLETFLELYDEVARDCNVTEICSA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
ggatgcagacctcgcgccttcttcctctacaaccggcacacaactcggtacccggacagg
gagaacatcgtcgagatgcaagacgtgcttccccagctcctcagaaacatcttgagcgca
gcacaggaaaaaaaagtccacatctgcgagactgacctcgagcaactggagcgctggaag
atgcccttcaagccacaccacgacaacaaggtgacgccaagtgggaaatctgtggtcggc
gaccaagtgcgcaggttaaggaggaggttcccgggcctgttccaaggacagttcaatgcc
agcgacttcgtggtgggctacacaagccgcgaacgaacccggcagacggcggaagccttc
ctcgagcacctgctatcgaagcaaggtgaaagacccgagttcctgccgtcaccgggctta
ggacggtttgctcaccacgagcaaagcgtcgatgcttttcccgccggattgcaggaaaag
aagtccacaccggtggaggtcgacaaatttgagaaaggaccgtacatgaagcgactcctt
gacacgatgtcttggcgtcttggattcaacacgagctttgtgtctcgggacgcagacgac
gtggacatcatgtaccgggcgtgcgtgtttgagtacgccatccacgacgcgtccccctgg
tgcgccgcgttcgacgaggccgagctcaaggccatcgagttccgggaggatctggacgac
tactacaaggatgcgtacggcctcaagcgcaactatgcccaggcatgccccatcgtgcga
gagctcgtcggccgcttcagaaacgtgagcaaggacccgtcgcagccaacgaagctgctc
tacttctcgcacgccggcggcttcaagaaagtagtggcgcgcctcggtctctaccgcgac
gccgagccgccgctggctgacggcctgtgccggcagtctggacgcgcctggcagtcgagc
ctggtgtgcccgttcaacgccaacctggccttcgtgctgtttgagtgcaccggcggcggc
caccaggtggcgacgttcctcaacgaggaggtccagcggctgcccgggtgtccgtcggag
agctgccccctggagacgttcttggaactgtacgatgaggttgcccgggactgcaacgtc
accgagatctgctccgcgtga

DBGET integrated database retrieval system